BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306C11f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 1.6 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 1.6 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 5.0 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 21 6.6 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = +2 Query: 269 KLKTNKRNPSDGGHIKRKTKLLFLLNSEH 355 K + K++P+DGG+ +K + + L+ ++ Sbjct: 556 KKRKRKQDPADGGNSMKKCRARYGLDQQN 584 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.0 bits (47), Expect = 1.6 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = +2 Query: 269 KLKTNKRNPSDGGHIKRKTKLLFLLNSEH 355 K + K++P+DGG+ +K + + L+ ++ Sbjct: 448 KKRKRKQDPADGGNSMKKCRARYGLDQQN 476 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.4 bits (43), Expect = 5.0 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = -3 Query: 273 SLF-YTKV*VLY-LSIEALRSLPGQLVMTINNTANFNAQ 163 SLF Y + V++ +E + +L G + TIN FN + Sbjct: 239 SLFGYQIILVIFDCCLETVSALNGAFLYTINGQGQFNIE 277 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 21.0 bits (42), Expect = 6.6 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -3 Query: 351 SEFNKNNNFVFLLMCPPSDGFLLFV 277 S+F+K + V +L P++ L+FV Sbjct: 392 SKFDKRSKLVSILEKAPNERTLIFV 416 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,490 Number of Sequences: 336 Number of extensions: 2312 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -