BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306C11f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1091 + 23899825-23900649,23900750-23900998,23901104-239011... 30 1.3 01_03_0206 - 13783169-13783651,13783761-13783903,13783962-137841... 29 1.7 >07_03_1091 + 23899825-23900649,23900750-23900998,23901104-23901195, 23901413-23902193 Length = 648 Score = 29.9 bits (64), Expect = 1.3 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +3 Query: 222 VAPQSINTRPKLSYKINLKQTKGIRPTGGTSKEKQNC 332 ++P S +TRP S K++L ++K + P SK K NC Sbjct: 471 LSPFSSHTRPTESPKLSLAESKPMTPLFCCSKPKCNC 507 >01_03_0206 - 13783169-13783651,13783761-13783903,13783962-13784128, 13784641-13785149,13786031-13786312,13786397-13786792, 13787232-13787504 Length = 750 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 19 IRLATRHFFRK*KLFISDRYNLFCNFWFNSW*LFC 123 +RL T+ +R KL I +NL C W +W L+C Sbjct: 336 LRLRTQRCYRSLKLNIP-LFNLSCKNWQKTWHLYC 369 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,241,083 Number of Sequences: 37544 Number of extensions: 228754 Number of successful extensions: 440 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 440 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -