BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306C11f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 52 2e-07 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 52 2e-07 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 52 2e-07 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 52 2e-07 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 52 2e-07 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 52 2e-07 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 48 4e-06 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 48 6e-06 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 43 2e-04 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 36 0.020 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.047 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_9891| Best HMM Match : KE2 (HMM E-Value=1) 27 7.1 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 519 HDVVKRRPVNCNTTHYRANW 460 HDVVKRRPVNCNTTHYRANW Sbjct: 5 HDVVKRRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 519 HDVVKRRPVNCNTTHYRANW 460 HDVVKRRPVNCNTTHYRANW Sbjct: 61 HDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 519 HDVVKRRPVNCNTTHYRANW 460 HDVVKRRPVNCNTTHYRANW Sbjct: 629 HDVVKRRPVNCNTTHYRANW 648 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 519 HDVVKRRPVNCNTTHYRANW 460 HDVVKRRPVNCNTTHYRANW Sbjct: 40 HDVVKRRPVNCNTTHYRANW 59 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 519 HDVVKRRPVNCNTTHYRANW 460 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 519 HDVVKRRPVNCNTTHYRANW 460 HDVVKRRPVNCNTTHYRANW Sbjct: 42 HDVVKRRPVNCNTTHYRANW 61 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 519 HDVVKRRPVNCNTTHYRANW 460 HDVVKRRPVNCNTTHYRANW Sbjct: 1880 HDVVKRRPVNCNTTHYRANW 1899 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 519 HDVVKRRPVNCNTTHYRANW 460 HDVVKRRPVNCNTTHYRANW Sbjct: 40 HDVVKRRPVNCNTTHYRANW 59 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 519 HDVVKRRPVNCNTTHYRANW 460 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 519 HDVVKRRPVNCNTTHYRANW 460 HDVVKRRPVNCNTTHYRANW Sbjct: 34 HDVVKRRPVNCNTTHYRANW 53 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 519 HDVVKRRPVNCNTTHYRANW 460 HDVVKRRPVNCNTTHYRANW Sbjct: 83 HDVVKRRPVNCNTTHYRANW 102 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 519 HDVVKRRPVNCNTTHYRANW 460 HDVVKRRPVNCNTTHYRANW Sbjct: 61 HDVVKRRPVNCNTTHYRANW 80 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 519 HDVVKRRPVNCNTTHYRANW 460 HDVVKRRPVNCNTTHYRANW Sbjct: 72 HDVVKRRPVNCNTTHYRANW 91 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 519 HDVVKRRPVNCNTTHYRANW 460 HDVVKRRPVNCNTTHYRANW Sbjct: 48 HDVVKRRPVNCNTTHYRANW 67 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 519 HDVVKRRPVNCNTTHYRANW 460 HDVVKRRPVNCNTTHYRANW Sbjct: 72 HDVVKRRPVNCNTTHYRANW 91 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 48.4 bits (110), Expect = 4e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +1 Query: 424 NRSSSSRGGARYPIRPIVSRITIHWPSFYN 513 +R++++ GGA PIRPIVSRITIHWP+FYN Sbjct: 29 SRAAATDGGA--PIRPIVSRITIHWPAFYN 56 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 48.0 bits (109), Expect = 5e-06 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = -3 Query: 519 HDVVKRRPVNCNTTHYRAN 463 HDVVKRRPVNCNTTHYRAN Sbjct: 22 HDVVKRRPVNCNTTHYRAN 40 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 47.6 bits (108), Expect = 6e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +1 Query: 424 NRSSSSRGGARYPIRPIVSRITIHWPSFYNVV 519 +R++++ GGA PIRPIVS ITIHWPSFYN V Sbjct: 31 SRAAATVGGA--PIRPIVSHITIHWPSFYNGV 60 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 42.7 bits (96), Expect = 2e-04 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -3 Query: 519 HDVVKRRPVNCNTTHYRAN 463 HD KRRPVNCNTTHYRAN Sbjct: 79 HDGEKRRPVNCNTTHYRAN 97 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.1 bits (92), Expect = 5e-04 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = +1 Query: 463 IRPIVSRITIHWPSFYNVV 519 +RP+VSRITIHW SFYNVV Sbjct: 33 LRPVVSRITIHWTSFYNVV 51 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.9 bits (89), Expect = 0.001 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 463 IRPIVSRITIHWPSFY 510 IRPIVSRITIHWPSFY Sbjct: 18 IRPIVSRITIHWPSFY 33 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 38.7 bits (86), Expect = 0.003 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 469 PIVSRITIHWPSFYNVV 519 P +SRITIHWPSFYNVV Sbjct: 77 PYMSRITIHWPSFYNVV 93 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 478 SRITIHWPSFYNVV 519 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 478 SRITIHWPSFYNVV 519 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 478 SRITIHWPSFYNVV 519 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 478 SRITIHWPSFYNVV 519 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 478 SRITIHWPSFYNVV 519 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 478 SRITIHWPSFYNVV 519 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 478 SRITIHWPSFYNVV 519 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 478 SRITIHWPSFYNVV 519 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 478 SRITIHWPSFYNVV 519 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 478 SRITIHWPSFYNVV 519 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 478 SRITIHWPSFYNVV 519 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 Query: 478 SRITIHWPSFYNVV 519 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.7 bits (76), Expect = 0.047 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +1 Query: 478 SRITIHWPSFYNVV 519 SRITIHWPSFYNV+ Sbjct: 2 SRITIHWPSFYNVM 15 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 430 SSSSRGGARYPIRPIVSRITIHWPSFYNVV 519 SS S+ R P HWPSFYNVV Sbjct: 36 SSGSQRSRRDPQSRPAGMQAWHWPSFYNVV 65 >SB_9891| Best HMM Match : KE2 (HMM E-Value=1) Length = 572 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 201 LADPADFVAPQSINTRPKLSYKINLKQTKGIR 296 LA P + PQS++ L YK K+T+ IR Sbjct: 349 LAAPTPILPPQSVHNTGGLGYKDKTKKTQKIR 380 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 27.1 bits (57), Expect = 9.4 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 493 HWPSFYNVV 519 HWPSFYNVV Sbjct: 5 HWPSFYNVV 13 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 27.1 bits (57), Expect = 9.4 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 493 HWPSFYNVV 519 HWPSFYNVV Sbjct: 62 HWPSFYNVV 70 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 27.1 bits (57), Expect = 9.4 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 Query: 493 HWPSFYNVV 519 HWPSFYNVV Sbjct: 5 HWPSFYNVV 13 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,203,528 Number of Sequences: 59808 Number of extensions: 268641 Number of successful extensions: 3547 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 3391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3547 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -