BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306C11f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 26 0.27 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 26 0.27 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 5.8 AB073997-1|BAC76401.1| 124|Apis mellifera preprotachykinin prot... 21 5.8 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 25.8 bits (54), Expect = 0.27 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 355 FSYLSTF*TFSGLPQIIQDQNLPNRSSSSRGGARYPIRPI 474 F Y T T S + + + ++LP R SSR R + PI Sbjct: 1817 FIYHGTSSTSSDISPMSEQKSLPRRGRSSRSSLRTLLPPI 1856 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 25.8 bits (54), Expect = 0.27 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 355 FSYLSTF*TFSGLPQIIQDQNLPNRSSSSRGGARYPIRPI 474 F Y T T S + + + ++LP R SSR R + PI Sbjct: 1813 FIYHGTSSTSSDISPMSEQKSLPRRGRSSRSSLRTLLPPI 1852 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 507 KRRPVNCNTTHYRANWVPGP 448 K++P +C+T YR V P Sbjct: 565 KKQPSDCDTLEYRNGEVTTP 584 >AB073997-1|BAC76401.1| 124|Apis mellifera preprotachykinin protein. Length = 124 Score = 21.4 bits (43), Expect = 5.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 281 NKRNPSDGGHIKRKTKLLFLLNSEHFHIY 367 +KR P+ ++ K K LNSE+F I+ Sbjct: 27 DKRAPTGHQEMQGKEKNSASLNSENFGIF 55 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,735 Number of Sequences: 438 Number of extensions: 2424 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -