BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306C09f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) 252 2e-67 SB_31360| Best HMM Match : No HMM Matches (HMM E-Value=.) 243 6e-65 SB_24678| Best HMM Match : No HMM Matches (HMM E-Value=.) 199 1e-51 SB_24677| Best HMM Match : No HMM Matches (HMM E-Value=.) 169 2e-42 SB_51693| Best HMM Match : Pro_isomerase (HMM E-Value=3.5e-19) 98 4e-21 SB_25950| Best HMM Match : Pro_isomerase (HMM E-Value=2.5e-24) 85 3e-17 SB_24676| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 8e-17 SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) 82 2e-16 SB_32917| Best HMM Match : Pro_isomerase (HMM E-Value=5.1e-23) 81 5e-16 SB_3070| Best HMM Match : Pro_isomerase (HMM E-Value=2.3e-05) 77 7e-15 SB_23239| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 5e-11 SB_21081| Best HMM Match : Pro_isomerase (HMM E-Value=0.11) 52 2e-07 SB_39222| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_42464| Best HMM Match : Pro_isomerase (HMM E-Value=3.9e-06) 39 0.002 SB_24028| Best HMM Match : DNA_photolyase (HMM E-Value=1.3e-39) 33 0.14 SB_6440| Best HMM Match : DUF638 (HMM E-Value=6.2) 32 0.33 SB_24760| Best HMM Match : PT (HMM E-Value=0.17) 31 0.44 SB_6387| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_40118| Best HMM Match : DREPP (HMM E-Value=0.085) 31 0.58 SB_19689| Best HMM Match : VWA (HMM E-Value=0.0035) 30 1.0 SB_3760| Best HMM Match : SVA (HMM E-Value=0.19) 30 1.0 SB_19447| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_51093| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_30500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_26973| Best HMM Match : DUF471 (HMM E-Value=1.1) 28 4.1 SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) 28 5.4 SB_15696| Best HMM Match : DUF282 (HMM E-Value=2.5) 28 5.4 SB_55431| Best HMM Match : DnaJ_C (HMM E-Value=7.2e-13) 27 7.1 SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) 27 7.1 SB_43146| Best HMM Match : Ank (HMM E-Value=0) 27 7.1 SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_46599| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_43957| Best HMM Match : Peptidase_M13_N (HMM E-Value=1.6e-13) 27 9.4 SB_16757| Best HMM Match : S-antigen (HMM E-Value=0.56) 27 9.4 SB_14859| Best HMM Match : SEA (HMM E-Value=0.01) 27 9.4 SB_30749| Best HMM Match : FARP (HMM E-Value=0.032) 27 9.4 SB_12627| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_1649| Best HMM Match : ANF_receptor (HMM E-Value=1.2e-05) 27 9.4 >SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) Length = 298 Score = 252 bits (616), Expect = 2e-67 Identities = 111/148 (75%), Positives = 126/148 (85%) Frame = +1 Query: 76 PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPNFMLQ 255 PRVFFD+T+ + G+IV+ELRSDV P T ENFR LCT EKGFGYKGS FHR+IP FM Q Sbjct: 137 PRVFFDITIGERSAGRIVMELRSDVVPMTAENFRCLCTHEKGFGYKGSSFHRIIPQFMCQ 196 Query: 256 GGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLD 435 GGDFT HNGTGGKSIYG KFEDENF LKHTG GVLSMAN+G +TNGSQFF+TT KT WLD Sbjct: 197 GGDFTKHNGTGGKSIYGAKFEDENFVLKHTGAGVLSMANSGPNTNGSQFFLTTEKTDWLD 256 Query: 436 GRHVVFGNVVEGMEVVKQIETFGSQSGK 519 G+HVVFGNV+EG +VV+++E GSQSGK Sbjct: 257 GKHVVFGNVIEGFDVVRKMEAVGSQSGK 284 >SB_31360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 243 bits (595), Expect = 6e-65 Identities = 109/145 (75%), Positives = 122/145 (84%) Frame = +1 Query: 85 FFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPNFMLQGGD 264 +FD+ + AP G+IV+ELR DV PKT ENFRALCTGEKGFGYKGS FHRVIP FM QGGD Sbjct: 6 YFDIEIGGAPAGRIVMELRDDVVPKTAENFRALCTGEKGFGYKGSSFHRVIPGFMCQGGD 65 Query: 265 FTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGRH 444 FT +GTGGKSIYG KF DENF LKHTGPG+LSMANAG TNGSQFF+ T KTSWLDG+H Sbjct: 66 FTRGDGTGGKSIYGAKFADENFNLKHTGPGILSMANAGPGTNGSQFFLCTAKTSWLDGKH 125 Query: 445 VVFGNVVEGMEVVKQIETFGSQSGK 519 VVFG+V +GM+VVK+IE GS SGK Sbjct: 126 VVFGSVKDGMDVVKKIEKVGSDSGK 150 >SB_24678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 199 bits (486), Expect = 1e-51 Identities = 89/139 (64%), Positives = 108/139 (77%) Frame = +1 Query: 79 RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPNFMLQG 258 +V+ DV++ P G++++ L D PKT NF AL E+GFGYK SIFHRVI NFM+QG Sbjct: 27 KVWMDVSIGGQPAGRVILGLFGDTAPKTVANFVALADKEQGFGYKDSIFHRVIKNFMIQG 86 Query: 259 GDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDG 438 GDFTN +GTGG SIYG F+DENF LKH GPG L MANAG +TNGSQF+ITT+KTSWLDG Sbjct: 87 GDFTNKDGTGGYSIYGKYFDDENFNLKHYGPGWLCMANAGKNTNGSQFYITTIKTSWLDG 146 Query: 439 RHVVFGNVVEGMEVVKQIE 495 H FG V+EGM+VV++IE Sbjct: 147 SHTCFGKVLEGMDVVRRIE 165 >SB_24677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 169 bits (410), Expect = 2e-42 Identities = 90/152 (59%), Positives = 105/152 (69%), Gaps = 18/152 (11%) Frame = +1 Query: 79 RVFFDVTVDDAPLGKI------VIELRSDVTPKTCE-----NFRAL-----CT--GEKGF 204 +VFFD+T+ G+I +I+ + + E NFR CT +KGF Sbjct: 28 KVFFDITIGGEKAGRIEIGLFVIIKTYYLLATRLVESLIGTNFRYFDTYYCCTIESQKGF 87 Query: 205 GYKGSIFHRVIPNFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGAD 384 GYK SIFHRVI +FM+QGGDFT +GTGGKSIYG KF DENF L+H G G LSMANAG D Sbjct: 88 GYKNSIFHRVIQDFMIQGGDFTKGDGTGGKSIYGQKFADENFKLQHYGAGWLSMANAGKD 147 Query: 385 TNGSQFFITTVKTSWLDGRHVVFGNVVEGMEV 480 TNGSQFFITTVKT WLDGRHVVFG V++GMEV Sbjct: 148 TNGSQFFITTVKTPWLDGRHVVFGKVLKGMEV 179 >SB_51693| Best HMM Match : Pro_isomerase (HMM E-Value=3.5e-19) Length = 99 Score = 97.9 bits (233), Expect = 4e-21 Identities = 45/73 (61%), Positives = 57/73 (78%), Gaps = 1/73 (1%) Frame = +1 Query: 277 NGTGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGRHVVF 453 +GTGG+SI+G +FEDE + L+H P +SMANAG +TNGSQFFIT V T WLD +H VF Sbjct: 2 DGTGGESIWGGEFEDEFHRNLRHDRPYTVSMANAGPNTNGSQFFITVVPTPWLDNKHTVF 61 Query: 454 GNVVEGMEVVKQI 492 G VV+GM+V +QI Sbjct: 62 GRVVKGMDVAQQI 74 >SB_25950| Best HMM Match : Pro_isomerase (HMM E-Value=2.5e-24) Length = 145 Score = 85.4 bits (202), Expect = 3e-17 Identities = 36/72 (50%), Positives = 50/72 (69%) Frame = +1 Query: 280 GTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGRHVVFGN 459 G GG+S+YG FEDE+F++ H GV+ MAN G TNGSQF+IT W+D ++V FG Sbjct: 46 GIGGESVYGPLFEDEDFSVAHNRRGVVGMANKGRHTNGSQFYITLQPAPWMDTKYVAFGQ 105 Query: 460 VVEGMEVVKQIE 495 V+EG+ V+ +E Sbjct: 106 VIEGLNVLDVLE 117 >SB_24676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 83.8 bits (198), Expect = 8e-17 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = +1 Query: 364 MANAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 495 MANAG DTNGSQFFITTVKTSWLDG+HVVFG V+EGM+VV+++E Sbjct: 1 MANAGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKLE 44 >SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) Length = 741 Score = 82.2 bits (194), Expect = 2e-16 Identities = 36/53 (67%), Positives = 46/53 (86%) Frame = +1 Query: 337 KHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 495 +H PG+LSMAN+G +TNGSQFFITTV T LDGRHVVFG V++GM+VV+++E Sbjct: 188 EHDKPGLLSMANSGPNTNGSQFFITTVPTPHLDGRHVVFGKVLKGMDVVRELE 240 >SB_32917| Best HMM Match : Pro_isomerase (HMM E-Value=5.1e-23) Length = 378 Score = 81.0 bits (191), Expect = 5e-16 Identities = 42/74 (56%), Positives = 51/74 (68%) Frame = +1 Query: 277 NGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGRHVVFG 456 NGTGG+SIYG F DE F KH P +LSMAN G +TNGSQFFI HVVFG Sbjct: 25 NGTGGESIYGGTFGDECFEFKHERPMLLSMANRGPNTNGSQFFII----------HVVFG 74 Query: 457 NVVEGMEVVKQIET 498 +V++G E+V+QIE+ Sbjct: 75 HVIQGEELVRQIES 88 >SB_3070| Best HMM Match : Pro_isomerase (HMM E-Value=2.3e-05) Length = 49 Score = 77.4 bits (182), Expect = 7e-15 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = +1 Query: 355 VLSMANAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQI 492 +LSMANAG TNGSQFF+ T KTSWLDG+HVVFG+V +GM+VVK++ Sbjct: 2 ILSMANAGPGTNGSQFFLCTAKTSWLDGKHVVFGSVKDGMDVVKKM 47 >SB_23239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 64.5 bits (150), Expect = 5e-11 Identities = 50/132 (37%), Positives = 69/132 (52%), Gaps = 6/132 (4%) Frame = +1 Query: 115 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPNFMLQGGDFTNHNGTGGK 294 LG+I IEL +D P + NF A + G+ Y G+ FHRVIP FM+QGG F + + Sbjct: 32 LGEIEIELDADKAPISTANFLAYV--DSGY-YAGTQFHRVIPGFMVQGGGF---DADMQQ 85 Query: 295 SIYGNKFEDENFTLKHTGPGVLSMANAGA-DTNGSQFFITTVKTSWLDG-----RHVVFG 456 ++E H G L+MA D+ SQFFI ++LD + VFG Sbjct: 86 KDTQAPIKNEADNGLHNVRGTLAMARTQVRDSATSQFFINHKDNAFLDHGSRDFGYAVFG 145 Query: 457 NVVEGMEVVKQI 492 VV+GM+VV +I Sbjct: 146 KVVKGMDVVDKI 157 >SB_21081| Best HMM Match : Pro_isomerase (HMM E-Value=0.11) Length = 48 Score = 52.4 bits (120), Expect = 2e-07 Identities = 26/46 (56%), Positives = 30/46 (65%), Gaps = 8/46 (17%) Frame = +1 Query: 118 GKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGSIFHR 231 G+++ EL +D PKT ENFRALCTGEKG G YKG FHR Sbjct: 2 GRVLFELFADKVPKTAENFRALCTGEKGIGPSTGKPLHYKGCPFHR 47 >SB_39222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1651 Score = 41.5 bits (93), Expect = 4e-04 Identities = 19/39 (48%), Positives = 25/39 (64%) Frame = +1 Query: 340 HTGPGVLSMANAGADTNGSQFFITTVKTSWLDGRHVVFG 456 H G +SMAN G ++NGSQFFI K LD ++ +FG Sbjct: 301 HNARGTVSMANNGPNSNGSQFFICYGKQPHLDMKYTMFG 339 >SB_42464| Best HMM Match : Pro_isomerase (HMM E-Value=3.9e-06) Length = 454 Score = 39.1 bits (87), Expect = 0.002 Identities = 26/65 (40%), Positives = 35/65 (53%) Frame = +1 Query: 115 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPNFMLQGGDFTNHNGTGGK 294 +G I IEL TPK C NF LC +G+ Y +IFHR++ +GG+ N G G Sbjct: 12 VGDIDIELWGKETPKACRNFIQLCL--EGY-YDNTIFHRIV-----KGGE--NIYGQSGF 61 Query: 295 SIYGN 309 + GN Sbjct: 62 KVTGN 66 >SB_24028| Best HMM Match : DNA_photolyase (HMM E-Value=1.3e-39) Length = 432 Score = 33.1 bits (72), Expect = 0.14 Identities = 23/97 (23%), Positives = 43/97 (44%) Frame = +2 Query: 35 CKLLTLLIPAKCLYHEYSSTSLLTMPHWEKLLLS*EVTSLPRRVKTSVPCALARKASVTR 214 C+L L C S +L T E LS V+ + + T+V C L ++ Sbjct: 333 CQLKALSTTVSC-----QSKALSTTVSCELKALSTTVSCELKALSTTVSCQLKALSTTVS 387 Query: 215 APFSIVSSPISCCKEGTSPTITALGESPSTAISLKTR 325 +S+ +SC + S T++ ++ ST +S +++ Sbjct: 388 CELKALSTTVSCQSKALSTTVSCQSKALSTTVSCQSK 424 Score = 29.5 bits (63), Expect = 1.8 Identities = 18/79 (22%), Positives = 38/79 (48%) Frame = +2 Query: 89 STSLLTMPHWEKLLLS*EVTSLPRRVKTSVPCALARKASVTRAPFSIVSSPISCCKEGTS 268 S +L T + LS V+ + + T+V C L ++ +S+ +SC + S Sbjct: 324 SKALSTTVSCQLKALSTTVSCQSKALSTTVSCELKALSTTVSCELKALSTTVSCQLKALS 383 Query: 269 PTITALGESPSTAISLKTR 325 T++ ++ ST +S +++ Sbjct: 384 TTVSCELKALSTTVSCQSK 402 >SB_6440| Best HMM Match : DUF638 (HMM E-Value=6.2) Length = 175 Score = 31.9 bits (69), Expect = 0.33 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +1 Query: 442 HVVFGNVVEGMEVVKQIET 498 HVVFG+V++G E+V+QIE+ Sbjct: 3 HVVFGHVIQGEELVRQIES 21 >SB_24760| Best HMM Match : PT (HMM E-Value=0.17) Length = 422 Score = 31.5 bits (68), Expect = 0.44 Identities = 18/46 (39%), Positives = 20/46 (43%) Frame = -1 Query: 482 TTSMPSTTFPKTTCLPSSQEVLTVVMKNWEPLVSAPALAMERTPGP 345 TT PST P T PS+ E +T WEP P PGP Sbjct: 34 TTGEPSTWEPMTGA-PSTWEPMTGAPSTWEPWTDGPGPYPTDGPGP 78 Score = 31.1 bits (67), Expect = 0.58 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -1 Query: 455 PKTTCLPSSQEVLTVVMKNWEPLVSAPALAMERTPGP 345 P TT PS+ E +T WEP+ AP+ T GP Sbjct: 32 PFTTGEPSTWEPMTGAPSTWEPMTGAPSTWEPWTDGP 68 >SB_6387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 31.5 bits (68), Expect = 0.44 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -1 Query: 485 LTTSMPSTTFPKTTCLPSSQEVLTVVMKNWEPLVSAPALAMERTPGP 345 L+ + + FP TT P + + T + EPL+ P +R P P Sbjct: 13 LSATQLTAAFPTTTTTPVTTQTTTTDVSRTEPLIELPTAQEKRKPCP 59 >SB_40118| Best HMM Match : DREPP (HMM E-Value=0.085) Length = 512 Score = 31.1 bits (67), Expect = 0.58 Identities = 23/57 (40%), Positives = 30/57 (52%) Frame = -3 Query: 516 PRLAAKGLNLLDNFHAFNNIPKDNMSAIQPGGLDSGDEELGTISISTGISHGEDARS 346 PR A +GL D F+ K+ MS I+PGG D +EE T S G + E A+S Sbjct: 443 PRRAGEGLPHSDFKSGFSY--KEYMSGIRPGGPDMEEEEKATPQ-SNGDASDEKAQS 496 >SB_19689| Best HMM Match : VWA (HMM E-Value=0.0035) Length = 885 Score = 30.3 bits (65), Expect = 1.0 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +1 Query: 109 APLGKIVIELRSDVTPKTCENFRALCTG 192 AP I+I L S V+PKT E+ R LC G Sbjct: 569 APKIDIIIALDSGVSPKTFEDERQLCAG 596 >SB_3760| Best HMM Match : SVA (HMM E-Value=0.19) Length = 259 Score = 30.3 bits (65), Expect = 1.0 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 5/43 (11%) Frame = -1 Query: 458 FPKTTCLPSSQE-----VLTVVMKNWEPLVSAPALAMERTPGP 345 FP+ + LP S E +LT++++N P ++APA + P P Sbjct: 81 FPQPSLLPPSSESFDITLLTILLRNICPTLTAPATGWDALPAP 123 >SB_19447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1110 Score = 29.5 bits (63), Expect = 1.8 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 5/43 (11%) Frame = -1 Query: 458 FPKTTCLPSSQE-----VLTVVMKNWEPLVSAPALAMERTPGP 345 FP+ LP S E +LT++++N P ++APA + P P Sbjct: 81 FPQPPLLPPSSESFDITLLTILLRNICPTLTAPATGWDALPAP 123 >SB_51093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 29.1 bits (62), Expect = 2.3 Identities = 18/62 (29%), Positives = 27/62 (43%) Frame = -1 Query: 503 PKVSICLTTSMPSTTFPKTTCLPSSQEVLTVVMKNWEPLVSAPALAMERTPGPVCLRVKF 324 P+ TTS PST+ P+T ++ T N AP+ + RT + LR Sbjct: 87 PRTGSTTTTSAPSTSTPRTGSTTTTSAPSTSTTSN--STTRAPSTSTPRTGSTITLRTST 144 Query: 323 SS 318 +S Sbjct: 145 TS 146 >SB_30500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2014 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -1 Query: 188 VHRARKFSHVLGV--TSLLSSITIFPSGASSTVTSKNTRGRDILPV 57 + + KF+H+ G+ TS T+F +T T TR RD++ + Sbjct: 168 IQQLHKFTHIHGMLSTSSRGRYTLFRGQYDTTATQIYTRSRDVIDI 213 >SB_26973| Best HMM Match : DUF471 (HMM E-Value=1.1) Length = 674 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 194 RKASVTRAPFSIVSSPISCCKEGTSPTITALGESP 298 +K R S V SC +EG SPT T+ G++P Sbjct: 276 KKPFSNREAHSCVELCRSCVREGCSPTPTSRGDAP 310 >SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) Length = 2123 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/57 (28%), Positives = 23/57 (40%) Frame = -1 Query: 515 PDWLPKVSICLTTSMPSTTFPKTTCLPSSQEVLTVVMKNWEPLVSAPALAMERTPGP 345 P P + TT+ P TT P+TT P + T + P + P +T P Sbjct: 1767 PPHSPPTTTTTTTTTPETTAPRTT-TPETTTPETTTPRTTTPETTKPRTTTPKTTTP 1822 >SB_15696| Best HMM Match : DUF282 (HMM E-Value=2.5) Length = 128 Score = 27.9 bits (59), Expect = 5.4 Identities = 20/44 (45%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +2 Query: 179 PCALARKASVTRAPFSIVSSPISCCKE-GTSPTITA-LGESPST 304 PCALA SV+ P S VSS + G S TI+A SP T Sbjct: 48 PCALATAPSVSEVPASTVSSSSPLRRSPGPSGTISASTSGSPRT 91 >SB_55431| Best HMM Match : DnaJ_C (HMM E-Value=7.2e-13) Length = 278 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 169 NFRALCTGEKGFGYKGSIF 225 NF + TG+KGFG++G F Sbjct: 67 NFSSYSTGQKGFGFEGMDF 85 >SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) Length = 161 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 169 NFRALCTGEKGFGYKGSIF 225 NF + TG+KGFG++G F Sbjct: 132 NFSSYSTGQKGFGFEGMDF 150 >SB_43146| Best HMM Match : Ank (HMM E-Value=0) Length = 282 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -1 Query: 233 TRWKMEPL*PKPFSPVHRARKFSHVLGVTSLL 138 TR+ +EP K F+P+H A ++ HV V LL Sbjct: 3 TRYPIEPA--KGFTPLHEAARYGHVHIVKLLL 32 >SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5659 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = -1 Query: 506 LPKVSICL-TTSMPSTTFPKTTCLPSSQEVLTV-VMKNWEPLVSAPALAMERTPGP 345 +P+ ++ L TT+ P TT P T + S + +V M + S +A E T P Sbjct: 1626 VPETTLALETTTAPETTLPPETTMASESTLASVTTMAPESTVASVTTMAPESTLAP 1681 >SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2323 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/62 (32%), Positives = 25/62 (40%), Gaps = 1/62 (1%) Frame = +1 Query: 259 GDFTNHNGTGGKSIYGNK-FEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLD 435 G T GTGG S N + T PGV AN G S + ++ TSW + Sbjct: 313 GAGTGGPGTGGPSGSSNPPTTGTPASASPTAPGVKGGANGGDCFRDSCYIFSSEGTSWTE 372 Query: 436 GR 441 R Sbjct: 373 NR 374 >SB_46599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4482 Score = 27.1 bits (57), Expect = 9.4 Identities = 19/56 (33%), Positives = 26/56 (46%) Frame = +2 Query: 224 SIVSSPISCCKEGTSPTITALGESPSTAISLKTRISPLSTLDLASSPWLMPVLILM 391 SIVS+ IS C T P+ T S+ + K I L D ++ P LIL+ Sbjct: 1087 SIVSNRISFCFNFTGPSFTVDTACSSSLTAFKLAIDNLQNGDCEAAIVCAPNLILI 1142 >SB_43957| Best HMM Match : Peptidase_M13_N (HMM E-Value=1.6e-13) Length = 560 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/52 (23%), Positives = 20/52 (38%) Frame = -3 Query: 231 TMENGALVTEAFLASAQGTEVFTRLGSDVTSQLNNNFSQWGIVNSDVEEYSW 76 T + L F S RLG + ++L F W +++ E +W Sbjct: 95 TKDKAVLKALHFYDSCMDKAEIERLGGEPLTKLIKEFGSWAVIDKSWNETNW 146 >SB_16757| Best HMM Match : S-antigen (HMM E-Value=0.56) Length = 1566 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +2 Query: 143 VTSLPRRVKTSVPCALARKASVTRAPFSIVSSPIS 247 VT LP VK + + ASVT P S+ P+S Sbjct: 1224 VTQLPVSVKHLLTSVMHLHASVTHLPASVTQLPVS 1258 >SB_14859| Best HMM Match : SEA (HMM E-Value=0.01) Length = 1776 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/53 (28%), Positives = 21/53 (39%) Frame = -1 Query: 503 PKVSICLTTSMPSTTFPKTTCLPSSQEVLTVVMKNWEPLVSAPALAMERTPGP 345 P TT+ P TT P+TT P + T + P+ + P T P Sbjct: 155 PSPPTTTTTTTPETTAPRTT-TPETTTPETTTPRTTTPVTTTPRTTTPETTTP 206 >SB_30749| Best HMM Match : FARP (HMM E-Value=0.032) Length = 2565 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/56 (25%), Positives = 22/56 (39%) Frame = -1 Query: 482 TTSMPSTTFPKTTCLPSSQEVLTVVMKNWEPLVSAPALAMERTPGPVCLRVKFSSS 315 T TF LP ++ + + + P E+TPG C +VK+ S Sbjct: 2328 TVGASDNTFVPAFALPEQNKMTATIRR----IAKTPGKHSEKTPGKACKQVKYIMS 2379 >SB_12627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 444 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +2 Query: 209 TRAPFSIVSSPISCCKEGTSPTITALGESPSTAISLKTRISPLSTL 346 + A S+ S SC E S + G IS+K+++SPL+ + Sbjct: 360 SEASVSLTESVSSCSYESGSHLSASPGREEMGEISVKSKVSPLANV 405 >SB_1649| Best HMM Match : ANF_receptor (HMM E-Value=1.2e-05) Length = 481 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = -1 Query: 197 FSPVHRARKFSHVLGVTSLLSSITIFPSGASSTVTSKNTRGRDILPVL 54 +SPVH K + + V + I + + +S+ RG ++L V+ Sbjct: 321 YSPVHNVEKSKNAITVLDTMKKIKVVGTTGQIHFSSEGERGGEMLDVM 368 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,050,319 Number of Sequences: 59808 Number of extensions: 448304 Number of successful extensions: 1522 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 1367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1515 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -