BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306C06f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC550.11 |||karyopherin|Schizosaccharomyces pombe|chr 3|||Manual 28 0.73 SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual 25 5.2 >SPCC550.11 |||karyopherin|Schizosaccharomyces pombe|chr 3|||Manual Length = 1029 Score = 28.3 bits (60), Expect = 0.73 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -1 Query: 263 FFFQLPSFFRVHSLLKVLIVVISSKLLGATQYSHSTND 150 +F +PSF RVH L+ ++S LGA Q + + D Sbjct: 833 WFENIPSFTRVHDKKLSLVAILSVISLGAQQVAVAIQD 870 >SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual Length = 4717 Score = 25.4 bits (53), Expect = 5.2 Identities = 15/64 (23%), Positives = 30/64 (46%) Frame = +2 Query: 35 VASKQSKNFSNRFSSFGAYSIQTNKQIFPLYNISIDFNNHLYCVNTELHQAVLKKSPQLE 214 + S + N N SSF N+ I PLY+ ++F +N + + ++ S + Sbjct: 2793 LVSTEISNTPNIDSSFSTVYRSLNESIVPLYS-ELEFFMKSVVLNQYIFELAMRLSKESN 2851 Query: 215 LSIV 226 +++V Sbjct: 2852 IAVV 2855 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,771,937 Number of Sequences: 5004 Number of extensions: 29712 Number of successful extensions: 70 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -