BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306C06f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0190 + 15170991-15171369,15172048-15172273,15172626-15172746 27 6.9 >12_02_0190 + 15170991-15171369,15172048-15172273,15172626-15172746 Length = 241 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +2 Query: 17 ISLGDS-VASKQSKNFSNRFSSFGAYSIQTNKQIFPLYNIS 136 +S GDS + ++ S N N GAY +Q ++ +FP+ +S Sbjct: 179 VSPGDSDIDTESSTNLQNSSVIRGAYDMQIDEPLFPVNPLS 219 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,354,040 Number of Sequences: 37544 Number of extensions: 133531 Number of successful extensions: 224 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 218 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 224 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -