BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306C06f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1021| Best HMM Match : Sec2p (HMM E-Value=1.9) 29 3.1 SB_43198| Best HMM Match : KIX (HMM E-Value=1.4) 27 7.1 >SB_1021| Best HMM Match : Sec2p (HMM E-Value=1.9) Length = 451 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 14 PISLGDSVASKQSKNFSNRFSSFGAYSIQTNKQIFPLYN 130 P+ LGD AS+ K +++ SSF + K+ FP Y+ Sbjct: 413 PVPLGDETASQPQKPRNDKHSSFDKLMVAL-KESFPAYS 450 >SB_43198| Best HMM Match : KIX (HMM E-Value=1.4) Length = 209 Score = 27.5 bits (58), Expect = 7.1 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 5/74 (6%) Frame = +2 Query: 53 KNFSNRFS-SFGAYSIQTNKQIFPLYNISIDFN----NHLYCVNTELHQAVLKKSPQLEL 217 KN RFS S Y+I +I P + +N NHL V+ LH+ V Sbjct: 50 KNAQKRFSTSVEEYTIGKMSKIMPSSEVQFQYNDQFDNHLVTVHEALHKNVYDTVDLKVK 109 Query: 218 SIVNVL*KMKVVEK 259 +I K+ +++K Sbjct: 110 AITKQEEKLSIIKK 123 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,877,917 Number of Sequences: 59808 Number of extensions: 178454 Number of successful extensions: 312 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 301 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 312 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -