BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306C05f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 23 1.4 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 23 2.5 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 22 4.4 >DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. Length = 132 Score = 23.4 bits (48), Expect = 1.4 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 286 EKLTKLITHEIKEVVYPFGDITDPVTGKKVSK 381 E+ TKL + ++ +V DIT+ + KK SK Sbjct: 86 ERTTKLDSEQVNRLVNNCKDITESNSCKKSSK 117 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.6 bits (46), Expect = 2.5 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +1 Query: 115 LGQCVPTVKQNAA 153 LG C P VKQ AA Sbjct: 13 LGVCAPNVKQRAA 25 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 21.8 bits (44), Expect = 4.4 Identities = 6/15 (40%), Positives = 12/15 (80%) Frame = -3 Query: 60 FLMIRFAVFLYFENI 16 F++I + +FLYF ++ Sbjct: 16 FILINYFIFLYFNSL 30 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,705 Number of Sequences: 438 Number of extensions: 3034 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -