BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306C04f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. 25 1.2 AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. 25 1.2 AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. 25 1.2 AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. 25 1.2 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 25 1.2 AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection... 23 4.7 AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram nega... 23 4.7 AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram nega... 23 4.7 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 6.2 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 23 8.2 >AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 235 CSAFMSFVTIFLECPDGSKWLVCSDASFLVRC 140 CS SF F E DG + +CS +RC Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 235 CSAFMSFVTIFLECPDGSKWLVCSDASFLVRC 140 CS SF F E DG + +CS +RC Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 235 CSAFMSFVTIFLECPDGSKWLVCSDASFLVRC 140 CS SF F E DG + +CS +RC Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 235 CSAFMSFVTIFLECPDGSKWLVCSDASFLVRC 140 CS SF F E DG + +CS +RC Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 235 CSAFMSFVTIFLECPDGSKWLVCSDASFLVRC 140 CS SF F E DG + +CS +RC Sbjct: 623 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 654 >AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection responsive shortpeptide protein. Length = 81 Score = 23.4 bits (48), Expect = 4.7 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +2 Query: 317 CQTKGGRYCGY 349 C++ G RYCGY Sbjct: 32 CKSIGARYCGY 42 >AJ001042-1|CAA04496.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 23.4 bits (48), Expect = 4.7 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +3 Query: 72 FFDEYDYYNFDHDKHIFTGHGG 137 F D +D+++F+ +H+ T GG Sbjct: 64 FEDNFDFFDFEKWEHVNTLAGG 85 >AF081533-1|AAD29854.1| 395|Anopheles gambiae putative gram negative bacteria bindingprotein protein. Length = 395 Score = 23.4 bits (48), Expect = 4.7 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +3 Query: 72 FFDEYDYYNFDHDKHIFTGHGG 137 F D +D+++F+ +H+ T GG Sbjct: 64 FEDNFDFFDFEKWEHVNTLAGG 85 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.0 bits (47), Expect = 6.2 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = -2 Query: 406 NALDVPSISETSIHPN 359 N L+ PS++E+S+ PN Sbjct: 1005 NRLESPSLNESSLSPN 1020 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 22.6 bits (46), Expect = 8.2 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +3 Query: 78 DEYDYYNFDHDKHIFTGHGG 137 D + YY H F G+GG Sbjct: 122 DSFVYYRKQHRPEYFKGYGG 141 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 545,203 Number of Sequences: 2352 Number of extensions: 11864 Number of successful extensions: 21 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -