BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306B12f (513 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1002.05c |jmj2||histone demethylase Jmj2 |Schizosaccharomyce... 27 2.2 SPBC29A10.04 |psm1|smc1|mitotic cohesin complex subunit Psm1 |Sc... 26 2.9 SPAC29A4.09 |||rRNA processing protein Rrp17|Schizosaccharomyces... 26 3.8 SPCC1620.10 |cwf26||complexed with Cdc5 protein Cwf26 |Schizosac... 25 5.0 SPAC31A2.05c |mis4||cohesin loading factor Mis4|Schizosaccharomy... 25 6.7 SPAC1556.05c |||CGR1 family|Schizosaccharomyces pombe|chr 1|||Ma... 25 8.8 >SPAC1002.05c |jmj2||histone demethylase Jmj2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 715 Score = 26.6 bits (56), Expect = 2.2 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +2 Query: 305 CSGCSYIRSLRSSLCSIAVYCGFCSLHRSTLCFCSLYRSTL 427 C SY + S SI V C LH LC C L TL Sbjct: 664 CKAFSYFSQVACSCKSITV----CPLHIEYLCKCDLSNKTL 700 >SPBC29A10.04 |psm1|smc1|mitotic cohesin complex subunit Psm1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1233 Score = 26.2 bits (55), Expect = 2.9 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = -1 Query: 513 DVAPNFFTSCYDXCLGCQSSLRRRMEQKHRVLRYKEQKHR 394 D A N ++ G + LR+ EQK RY+ QK + Sbjct: 186 DKAVNLSAHSFNKKRGINAELRQYQEQKTEAERYQSQKEK 225 >SPAC29A4.09 |||rRNA processing protein Rrp17|Schizosaccharomyces pombe|chr 1|||Manual Length = 203 Score = 25.8 bits (54), Expect = 3.8 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -1 Query: 417 RYKEQKHRVLRCKEQKPQYTAMLHKELRSERM*EQPEQL 301 + + +KH ++ ++QK + L K LR +R E E+L Sbjct: 45 KVERRKHAQVQLEQQKREERLALRKSLREQRKRELAERL 83 >SPCC1620.10 |cwf26||complexed with Cdc5 protein Cwf26 |Schizosaccharomyces pombe|chr 3|||Manual Length = 305 Score = 25.4 bits (53), Expect = 5.0 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = -1 Query: 480 DXCLGCQSSLRRRMEQKHRVLRYKEQKHRVLRCKEQKPQYTAMLHKE 340 D L + + R+ E++ R KEQ+ V++ ++QK +Y L ++ Sbjct: 166 DLVLARKEAKRKLKEKEEEARRQKEQQQGVVQVRQQK-EYLKELERQ 211 >SPAC31A2.05c |mis4||cohesin loading factor Mis4|Schizosaccharomyces pombe|chr 1|||Manual Length = 1583 Score = 25.0 bits (52), Expect = 6.7 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +2 Query: 317 SYIRSLRSSLCSIAVYCGFCSLHRSTLCFCSLY 415 S++RSL S L G +L C CSL+ Sbjct: 1078 SFLRSLESVLLQRLTKAGTATLMEIVPCLCSLF 1110 >SPAC1556.05c |||CGR1 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 111 Score = 24.6 bits (51), Expect = 8.8 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -1 Query: 447 RRMEQKHRVLRYKEQKHRVLRCK-EQKPQYTAMLHKELRSERM*EQPEQLQLR 292 +RMEQK ++ KE++ + R K EQ+ + + +++ E+ E LQ + Sbjct: 37 KRMEQKRKLDEIKEREKELKREKEEQRAAHAEKIRTRRQAKADRERMELLQAK 89 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,396,326 Number of Sequences: 5004 Number of extensions: 20475 Number of successful extensions: 57 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 57 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 206265012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -