BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306B12f (513 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 26 0.65 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 25 1.1 AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. 25 2.0 AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. 25 2.0 DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 23 4.6 AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 23 4.6 AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. 23 6.1 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 26.2 bits (55), Expect = 0.65 Identities = 14/53 (26%), Positives = 29/53 (54%) Frame = -1 Query: 462 QSSLRRRMEQKHRVLRYKEQKHRVLRCKEQKPQYTAMLHKELRSERM*EQPEQ 304 ++++ R E++ R R +EQ+ + R KEQ+ + + + +R EQ E+ Sbjct: 463 EAAIEREKERELREQREREQREKEQREKEQREKEERERQQREKEQREREQREK 515 Score = 25.8 bits (54), Expect = 0.86 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -1 Query: 450 RRRMEQKHRVLRYKEQKHRVLRCKEQKPQYTAMLHKELRSERM*EQPEQ 304 +R EQ+ + R KE++ R R KEQ+ + +E + R E+ + Sbjct: 482 QREKEQREKEQREKEERERQQREKEQREREQREKEREREAARERERERE 530 Score = 25.0 bits (52), Expect = 1.5 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = -1 Query: 450 RRRMEQKHRVLRYKEQKHRVLRCKEQKPQYTAMLHKELRSERM*EQPEQ 304 R EQ+ R R KEQ+ + R KE++ + + R +R E+ + Sbjct: 472 RELREQREREQREKEQREKEQREKEERERQQREKEQREREQREKERERE 520 Score = 23.8 bits (49), Expect = 3.5 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = -1 Query: 435 QKHRVLRYKEQKHRVLRCKEQKPQYTAMLHKELRSERM*EQPEQLQ 298 +K R LR EQ+ R R KEQ+ + + R +R EQ E+ Q Sbjct: 469 EKERELR--EQREREQREKEQREKEQREKEERERQQREKEQREREQ 512 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 25.4 bits (53), Expect = 1.1 Identities = 24/90 (26%), Positives = 48/90 (53%), Gaps = 4/90 (4%) Frame = -1 Query: 456 SLRRRMEQKHRVLRYKEQKHRVLRCKEQK-PQYTAMLHKELRSERM*EQPEQL--QLR-T 289 ++RR+ E+ R L KEQK + L K+ + Q+++ KE R + + + + L Q++ Sbjct: 353 AMRRKEEECSRELNLKEQKRKELYAKQGRGSQFSS---KEERDKWIQGELKSLNKQIKDK 409 Query: 288 VLPLGLLVWQLERSCMKQGQLPKEQRQQLD 199 + L L++ KQG+L K+ ++ + Sbjct: 410 ISHQNKLQDDLKKDIAKQGELEKKIQEHTE 439 >AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 24.6 bits (51), Expect = 2.0 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -1 Query: 276 GLLVWQLERSCM 241 G +WQ+ERSCM Sbjct: 75 GSKIWQMERSCM 86 >AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 24.6 bits (51), Expect = 2.0 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -1 Query: 276 GLLVWQLERSCM 241 G +WQ+ERSCM Sbjct: 75 GSKIWQMERSCM 86 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 23.4 bits (48), Expect = 4.6 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 1 LQKCTKSYFSSPPSHWRQPNP 63 L+ ++ F P HWR NP Sbjct: 148 LKDLARTEFDRRPPHWRTSNP 168 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 23.4 bits (48), Expect = 4.6 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = -2 Query: 293 VRCCRWGY*SGSW 255 +R C WG+ S +W Sbjct: 279 IRTCHWGFNSSNW 291 >AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. Length = 356 Score = 23.0 bits (47), Expect = 6.1 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 288 VLPLGLLVWQLERSCMKQG 232 V LGL++W++ R C G Sbjct: 255 VYALGLVLWEIARRCNVDG 273 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 366,353 Number of Sequences: 2352 Number of extensions: 5725 Number of successful extensions: 22 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46514490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -