BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306B08f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Sc... 25 5.2 SPBC31F10.16 |||ChAPs family protein|Schizosaccharomyces pombe|c... 25 6.8 SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces po... 25 9.0 >SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 776 Score = 25.4 bits (53), Expect = 5.2 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +1 Query: 91 NMEDQ-GAKKILFNKSMLFSLKAELLRKQEEVLVKKQMPQHKAENFK 228 NMED+ ++ ++L S R E+ +KQM Q + ENFK Sbjct: 145 NMEDELRITRLASENNVLISRIDRTKRHFSELFTQKQMLQLQNENFK 191 >SPBC31F10.16 |||ChAPs family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 679 Score = 25.0 bits (52), Expect = 6.8 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = -2 Query: 358 QLFSPMPTLIFYLLVTPQR 302 +LF+P+ TL FY+L+T + Sbjct: 65 KLFTPIETLTFYVLLTSSK 83 >SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces pombe|chr 3|||Manual Length = 2812 Score = 24.6 bits (51), Expect = 9.0 Identities = 21/61 (34%), Positives = 30/61 (49%) Frame = -1 Query: 194 FFTRTSSCFLSSSAFRLNSIDLLNKIFLAP*SSIFKYFLLHV**VPIYYFDYFHLAKKIL 15 FF + SS LS + FR ++++ N I + +F L YF YF LAK IL Sbjct: 338 FFGKRSS--LSLANFRFHTVEPKNNIAKLYDPRLHLFFSLRHNSFFESYFIYFFLAKLIL 395 Query: 14 V 12 + Sbjct: 396 L 396 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,710,393 Number of Sequences: 5004 Number of extensions: 27468 Number of successful extensions: 61 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -