BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306B08f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46961| Best HMM Match : DUF663 (HMM E-Value=0) 28 4.1 SB_45420| Best HMM Match : TSP_1 (HMM E-Value=0.0024) 27 9.4 >SB_46961| Best HMM Match : DUF663 (HMM E-Value=0) Length = 491 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/51 (35%), Positives = 30/51 (58%) Frame = +1 Query: 76 NRKYLNMEDQGAKKILFNKSMLFSLKAELLRKQEEVLVKKQMPQHKAENFK 228 +++ + ME Q KK+ L++ E LRK++E LV+K+ H+AE K Sbjct: 410 SKRAVVMEPQ-EKKVYSLMQQLYTANKEKLRKRKEKLVQKR-KVHRAEQAK 458 >SB_45420| Best HMM Match : TSP_1 (HMM E-Value=0.0024) Length = 426 Score = 27.1 bits (57), Expect = 9.4 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 467 IVLVNSCCCCFFVL 426 I+L+ SCCCCF + Sbjct: 279 ILLIASCCCCFICI 292 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,132,765 Number of Sequences: 59808 Number of extensions: 179342 Number of successful extensions: 381 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 351 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 380 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -