BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306B07f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 26 0.88 AY752894-1|AAV30068.1| 156|Anopheles gambiae peroxidase 2 protein. 24 3.6 DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 23 6.2 DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. 23 6.2 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 25.8 bits (54), Expect = 0.88 Identities = 10/43 (23%), Positives = 25/43 (58%) Frame = -2 Query: 130 VKMLVYNVVDR*VFSNRWLRAVPSIISFLTDVFDGYSSFVSKL 2 V+ ++Y+ +DR + +W + + S L + F Y +F++++ Sbjct: 1724 VREIIYDEIDRPIMQTKWTK----LTSHLKEYFAFYENFITQV 1762 >AY752894-1|AAV30068.1| 156|Anopheles gambiae peroxidase 2 protein. Length = 156 Score = 23.8 bits (49), Expect = 3.6 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +1 Query: 10 KRMRNNHRRHQLEKRLLKEQRVANDSKTLICQQRYIPTF 126 KR+R HR E+ + +RV S I Y+P F Sbjct: 62 KRVRRQHRDWSDEEIFQRARRVVIASLQNIVAYEYLPAF 100 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 23.0 bits (47), Expect = 6.2 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +1 Query: 169 PIPEPTYNTQQTLIATPYFDGYLPLICITSASK 267 P+ P+Y T+ PY+ Y P IT++++ Sbjct: 175 PMYYPSYPTEANFQPHPYYPKYEPDAYITASTE 207 >DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. Length = 383 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -2 Query: 94 VFSNRWLRAVPSIISFL 44 +++NRWLR + S+I FL Sbjct: 265 IWNNRWLRTI-SVILFL 280 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 468,364 Number of Sequences: 2352 Number of extensions: 8698 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -