BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306B06f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 2.5 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 7.7 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 7.7 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 21 7.7 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 7.7 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 22.6 bits (46), Expect = 2.5 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -1 Query: 164 ICCLGTPLPGPSTSARVWSITSTTLTNF 81 I CL P PG S ++ + L+N+ Sbjct: 5 ISCLVAPFPGASANSEAKRLYDDLLSNY 32 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.0 bits (42), Expect = 7.7 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -3 Query: 243 RFPHETSRGC 214 ++PHE RGC Sbjct: 492 KWPHEDKRGC 501 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.0 bits (42), Expect = 7.7 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = -1 Query: 452 GIFFLPKVPARAAFTFKLLNTAVLARFLLTRAAVNLNLS*SVICARFSLFANF 294 GI L K P+R++ L ++L +V++ + RFS F F Sbjct: 543 GITILEKKPSRSSTLVSFLQPFSNTLWILVMVSVHVVALVLYLLDRFSPFGRF 595 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 168 LKPTPSHKIPPQI 206 +K P HK+PP I Sbjct: 62 VKYLPGHKLPPNI 74 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 239 KRGQMLNSMKNGQKVNGP 292 K ++ M NGQK+ GP Sbjct: 284 KISELEKEMLNGQKLQGP 301 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.0 bits (42), Expect = 7.7 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -3 Query: 243 RFPHETSRGC 214 ++PHE RGC Sbjct: 582 KWPHEDKRGC 591 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,943 Number of Sequences: 438 Number of extensions: 3138 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -