BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306B03f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 1.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 2.9 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 21 6.6 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 23.4 bits (48), Expect = 1.2 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +1 Query: 340 TSTLRSSTMLSQELEPTKKPSSRSCARFPTMVSVP 444 ++T+ +S+ + PT +S SC P+M P Sbjct: 10 STTMATSSNAMSPMTPTYSMNSMSCVSMPSMNCSP 44 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 2.9 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +3 Query: 387 DEEAIIEILCTLSNYGIRTISAFYEQLYGKSLESDLKGDPSGH 515 D ++ +++C +N+ A+Y Q GK L SD+ D H Sbjct: 1818 DPKSEFKVVCYFTNW------AWYRQGVGKYLPSDIDPDLCTH 1854 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.0 bits (42), Expect = 6.6 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 79 TSAPPRCTPRSLSTRPRMPRP 141 + A P PRS++T +P P Sbjct: 207 SKASPAAAPRSVATPTGIPTP 227 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,339 Number of Sequences: 336 Number of extensions: 2471 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -