BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306B03f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 23 1.4 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 23 2.5 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 5.8 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 23.4 bits (48), Expect = 1.4 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 359 PRCCLRNWNRRRSHHRDPVHAFQLWYPYHI 448 P CC + W+ ++S R +++ L YP I Sbjct: 364 PNCCGK-WSSQKSEPRRSIYSSLLRYPRSI 392 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.6 bits (46), Expect = 2.5 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 Query: 144 EGSRHPRPGRKAPRGTP 94 E R+P PG K PR P Sbjct: 53 EPRRNPGPGSKGPRDFP 69 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 5.8 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +2 Query: 98 VPRGAFRPGRGCRDPSQGYEGLRHR*EGYHRR 193 +P G F R R+ Y GLR +G R Sbjct: 276 LPEGLFASTRDLREIHLAYNGLRDLPKGIFTR 307 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,588 Number of Sequences: 438 Number of extensions: 2910 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -