BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306B01f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g23260.1 68414.m02910 ubiquitin-conjugating enzyme family pro... 138 2e-33 At2g36060.1 68415.m04427 ubiquitin-conjugating enzyme family pro... 136 6e-33 At3g52560.1 68416.m05784 ubiquitin-conjugating enzyme family pro... 135 1e-32 At1g70660.1 68414.m08146 ubiquitin-conjugating enzyme family pro... 135 2e-32 At2g36060.2 68415.m04428 ubiquitin-conjugating enzyme family pro... 132 1e-31 At3g52560.2 68416.m05785 ubiquitin-conjugating enzyme family pro... 131 3e-31 At5g25760.1 68418.m03057 ubiquitin-conjugating enzyme, putative ... 51 5e-07 At2g02760.1 68415.m00219 ubiquitin-conjugating enzyme 2 (UBC2) E... 50 1e-06 At1g14400.2 68414.m01708 ubiquitin-conjugating enzyme 1 (UBC1) E... 50 1e-06 At1g14400.1 68414.m01707 ubiquitin-conjugating enzyme 1 (UBC1) E... 50 1e-06 At5g62540.1 68418.m07849 ubiquitin-conjugating enzyme 3 (UBC3) E... 48 4e-06 At5g50870.1 68418.m06304 ubiquitin-conjugating enzyme, putative ... 46 2e-05 At3g08690.1 68416.m01010 ubiquitin-conjugating enzyme 11 (UBC11)... 46 2e-05 At1g36340.1 68414.m04516 ubiquitin-conjugating enzyme family pro... 46 2e-05 At5g41700.4 68418.m05071 ubiquitin-conjugating enzyme 8 (UBC8) E... 44 6e-05 At3g46460.1 68416.m05037 ubiquitin-conjugating enzyme 13 (UBC13)... 43 1e-04 At3g13550.1 68416.m01703 ubiquitin-conjugating enzyme (COP10) id... 43 1e-04 At5g59300.1 68418.m07430 ubiquitin-conjugating enzyme 7 (UBC7) E... 42 3e-04 At4g27960.2 68417.m04012 ubiquitin-conjugating enzyme E2-17 kDa ... 42 3e-04 At3g24515.1 68416.m03077 ubiquitin-conjugating enzyme, putative ... 41 4e-04 At3g08700.1 68416.m01011 ubiquitin-conjugating enzyme, putative ... 41 4e-04 At5g41700.3 68418.m05068 ubiquitin-conjugating enzyme 8 (UBC8) E... 41 6e-04 At5g41700.2 68418.m05070 ubiquitin-conjugating enzyme 8 (UBC8) E... 41 6e-04 At5g41700.1 68418.m05069 ubiquitin-conjugating enzyme 8 (UBC8) E... 41 6e-04 At5g53300.2 68418.m06625 ubiquitin-conjugating enzyme 10 (UBC10)... 40 8e-04 At5g53300.1 68418.m06624 ubiquitin-conjugating enzyme 10 (UBC10)... 40 8e-04 At1g64230.1 68414.m07276 ubiquitin-conjugating enzyme, putative ... 40 8e-04 At4g27960.1 68417.m04011 ubiquitin-conjugating enzyme E2-17 kDa ... 40 0.001 At2g16740.1 68415.m01920 ubiquitin-conjugating enzyme, putative ... 39 0.002 At1g78870.2 68414.m09194 ubiquitin-conjugating enzyme, putative ... 39 0.002 At1g78870.1 68414.m09193 ubiquitin-conjugating enzyme, putative ... 39 0.002 At1g16890.2 68414.m02044 ubiquitin-conjugating enzyme, putative ... 39 0.002 At3g55380.1 68416.m06151 ubiquitin-conjugating enzyme 14 (UBC14)... 38 0.003 At1g16890.1 68414.m02043 ubiquitin-conjugating enzyme, putative ... 38 0.004 At1g45050.1 68414.m05165 ubiquitin-conjugating enzyme 15 (UBC15)... 37 0.007 At5g05080.1 68418.m00539 ubiquitin-conjugating enzyme, putative ... 37 0.009 At2g32790.1 68415.m04014 ubiquitin-conjugating enzyme, putative ... 37 0.009 At3g17000.1 68416.m02171 ubiquitin-conjugating enzyme, putative ... 35 0.029 At5g42990.1 68418.m05243 ubiquitin-conjugating enzyme 18 (UBC18)... 34 0.050 At5g56150.2 68418.m07005 ubiquitin-conjugating enzyme, putative ... 34 0.067 At5g56150.1 68418.m07004 ubiquitin-conjugating enzyme, putative ... 34 0.067 At2g46030.1 68415.m05726 ubiquitin-conjugating enzyme 6 (UBC6) E... 33 0.088 At1g75440.1 68414.m08763 ubiquitin-conjugating enzyme 16 (UBC16)... 33 0.088 At1g50490.1 68414.m05662 ubiquitin-conjugating enzyme 20 (UBC20)... 33 0.12 At1g63800.1 68414.m07220 ubiquitin-conjugating enzyme 5 (UBC5) E... 33 0.15 At2g33770.1 68415.m04141 ubiquitin-conjugating enzyme family pro... 32 0.27 At4g36410.1 68417.m05173 ubiquitin-conjugating enzyme 17 (UBC17)... 31 0.36 At5g41340.1 68418.m05024 ubiquitin-conjugating enzyme 4 (UBC4) E... 31 0.62 At1g53020.1 68414.m06002 ubiquitin-conjugating enzyme family pro... 30 1.1 At3g57870.1 68416.m06451 ubiquitin-conjugating enzyme, putative ... 29 1.4 At1g55915.1 68414.m06413 expressed protein similar to Hypothetic... 29 1.4 At3g20060.1 68416.m02537 ubiquitin-conjugating enzyme 19 (UBC19)... 28 3.3 At5g16590.1 68418.m01942 leucine-rich repeat transmembrane prote... 28 4.4 At3g15355.1 68416.m01945 ubiquitin-conjugating enzyme-related si... 28 4.4 At5g08200.1 68418.m00959 peptidoglycan-binding LysM domain-conta... 27 5.8 At2g47310.1 68415.m05906 flowering time control protein-related ... 27 5.8 At2g31030.1 68415.m03783 oxysterol-binding family protein simila... 27 5.8 At2g16920.1 68415.m01949 ubiquitin-conjugating enzyme family pro... 27 5.8 >At1g23260.1 68414.m02910 ubiquitin-conjugating enzyme family protein similar to TRAF6-regulated IKK activator 1 beta Uev1A [Homo sapiens] GI:10880969; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 158 Score = 138 bits (334), Expect = 2e-33 Identities = 57/105 (54%), Positives = 80/105 (76%) Frame = +1 Query: 148 MANPSSGVVVPRNFRLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYE 327 M++ + VVVPRNFRLLEELE+G+KG+GDGT+S+G++ DD+ + WTG I+GPP T YE Sbjct: 1 MSSEEAKVVVPRNFRLLEELERGEKGIGDGTVSYGMDDADDIYMQSWTGTILGPPNTAYE 60 Query: 328 NRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQTGLVDNRQVP 462 +++ LK+ CG YP+ PPT RF +RI+M CVN +TG+V+ P Sbjct: 61 GKIFQLKLFCGKEYPESPPTVRFQTRINMACVNPETGVVEPSLFP 105 >At2g36060.1 68415.m04427 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 145 Score = 136 bits (330), Expect = 6e-33 Identities = 58/98 (59%), Positives = 77/98 (78%) Frame = +1 Query: 163 SGVVVPRNFRLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYS 342 S VVVPRNFRLLEELE+G+KG+GDGT+S+G++ DD+ + WTG IIGP T +E R+Y Sbjct: 7 SSVVVPRNFRLLEELERGEKGIGDGTVSYGMDDGDDIYMRSWTGTIIGPHNTVHEGRIYQ 66 Query: 343 LKIECGTRYPDEPPTARFISRIHMNCVNSQTGLVDNRQ 456 LK+ C YP++PPT RF SRI+M CVN TG+VD+++ Sbjct: 67 LKLFCDKDYPEKPPTVRFHSRINMTCVNHDTGVVDSKK 104 Score = 28.7 bits (61), Expect = 2.5 Identities = 12/36 (33%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = +2 Query: 419 VSIVKLDLWIID--KSPILARWQRDYTIKTVLQEVR 520 ++ V D ++D K +LA WQR YT++ +L +++ Sbjct: 90 MTCVNHDTGVVDSKKFGVLANWQRQYTMEDILTQLK 125 >At3g52560.1 68416.m05784 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 146 Score = 135 bits (327), Expect = 1e-32 Identities = 57/103 (55%), Positives = 79/103 (76%) Frame = +1 Query: 148 MANPSSGVVVPRNFRLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYE 327 + + S VVVPRNFRLLEELE+G+KG+GDGT+S+G++ DD+ + WTG IIGP T +E Sbjct: 3 LGSGGSSVVVPRNFRLLEELERGEKGIGDGTVSYGMDDGDDIYMRSWTGTIIGPHNTVHE 62 Query: 328 NRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQTGLVDNRQ 456 R+Y LK+ C YP++PPT RF SR++M CVN +TG+VD ++ Sbjct: 63 GRIYQLKLFCDKDYPEKPPTVRFHSRVNMACVNHETGVVDPKK 105 Score = 27.1 bits (57), Expect = 7.7 Identities = 9/22 (40%), Positives = 17/22 (77%) Frame = +2 Query: 455 KSPILARWQRDYTIKTVLQEVR 520 K +LA WQR+YT++ +L +++ Sbjct: 105 KFGLLANWQREYTMEDILVQLK 126 >At1g70660.1 68414.m08146 ubiquitin-conjugating enzyme family protein similar to TRAF6-regulated IKK activator 1 beta Uev1A [Homo sapiens] GI:10880969; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 159 Score = 135 bits (326), Expect = 2e-32 Identities = 57/105 (54%), Positives = 76/105 (72%) Frame = +1 Query: 148 MANPSSGVVVPRNFRLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYE 327 M + VVVPRNFRLLEELE+G+KG+GDGT+S+G++ DD+ + WTG I+GP T YE Sbjct: 1 MGSEEEKVVVPRNFRLLEELERGEKGIGDGTVSYGMDDADDILMQSWTGTILGPHNTAYE 60 Query: 328 NRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQTGLVDNRQVP 462 +++ LK+ CG YP+ PPT RF SRI+M CVN + G+VD P Sbjct: 61 GKIFQLKLFCGKDYPESPPTVRFQSRINMACVNPENGVVDPSHFP 105 >At2g36060.2 68415.m04428 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 146 Score = 132 bits (319), Expect = 1e-31 Identities = 58/99 (58%), Positives = 77/99 (77%), Gaps = 1/99 (1%) Frame = +1 Query: 163 SGVVVPRNFRLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPR-TPYENRMY 339 S VVVPRNFRLLEELE+G+KG+GDGT+S+G++ DD+ + WTG IIGP T +E R+Y Sbjct: 7 SSVVVPRNFRLLEELERGEKGIGDGTVSYGMDDGDDIYMRSWTGTIIGPHNVTVHEGRIY 66 Query: 340 SLKIECGTRYPDEPPTARFISRIHMNCVNSQTGLVDNRQ 456 LK+ C YP++PPT RF SRI+M CVN TG+VD+++ Sbjct: 67 QLKLFCDKDYPEKPPTVRFHSRINMTCVNHDTGVVDSKK 105 Score = 28.7 bits (61), Expect = 2.5 Identities = 12/36 (33%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = +2 Query: 419 VSIVKLDLWIID--KSPILARWQRDYTIKTVLQEVR 520 ++ V D ++D K +LA WQR YT++ +L +++ Sbjct: 91 MTCVNHDTGVVDSKKFGVLANWQRQYTMEDILTQLK 126 >At3g52560.2 68416.m05785 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 147 Score = 131 bits (316), Expect = 3e-31 Identities = 57/104 (54%), Positives = 79/104 (75%), Gaps = 1/104 (0%) Frame = +1 Query: 148 MANPSSGVVVPRNFRLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPR-TPY 324 + + S VVVPRNFRLLEELE+G+KG+GDGT+S+G++ DD+ + WTG IIGP T + Sbjct: 3 LGSGGSSVVVPRNFRLLEELERGEKGIGDGTVSYGMDDGDDIYMRSWTGTIIGPHNVTVH 62 Query: 325 ENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQTGLVDNRQ 456 E R+Y LK+ C YP++PPT RF SR++M CVN +TG+VD ++ Sbjct: 63 EGRIYQLKLFCDKDYPEKPPTVRFHSRVNMACVNHETGVVDPKK 106 Score = 27.1 bits (57), Expect = 7.7 Identities = 9/22 (40%), Positives = 17/22 (77%) Frame = +2 Query: 455 KSPILARWQRDYTIKTVLQEVR 520 K +LA WQR+YT++ +L +++ Sbjct: 106 KFGLLANWQREYTMEDILVQLK 127 >At5g25760.1 68418.m03057 ubiquitin-conjugating enzyme, putative similar to SP|O60015 Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) {Pichia angusta}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 157 Score = 50.8 bits (116), Expect = 5e-07 Identities = 22/58 (37%), Positives = 32/58 (55%) Frame = +1 Query: 265 DDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQTG 438 DD + WT +I GP TPYE ++ L YP +PP RF+++I V+ +TG Sbjct: 30 DDTNIFKWTALIKGPSETPYEGGVFQLAFSVPEPYPLQPPQVRFLTKIFHPNVHFKTG 87 >At2g02760.1 68415.m00219 ubiquitin-conjugating enzyme 2 (UBC2) E2; identical to gi:2689242, SP:P42745 Length = 152 Score = 49.6 bits (113), Expect = 1e-06 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = +1 Query: 178 PRNFRLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIEC 357 P RL+ + ++ Q+ G IS G D+++ L W +I GP TP++ + L ++ Sbjct: 4 PARKRLMRDFKRLQQDPPAG-IS-GAPQDNNIML--WNAVIFGPDDTPWDGGTFKLSLQF 59 Query: 358 GTRYPDEPPTARFISRI-HMN 417 YP++PPT RF+SR+ H N Sbjct: 60 SEDYPNKPPTVRFVSRMFHPN 80 >At1g14400.2 68414.m01708 ubiquitin-conjugating enzyme 1 (UBC1) E2; identical to gi:431259, SP:P25865 Length = 152 Score = 49.6 bits (113), Expect = 1e-06 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = +1 Query: 178 PRNFRLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIEC 357 P RL+ + ++ Q+ G IS G D+++ L W +I GP TP++ + L ++ Sbjct: 4 PARKRLMRDFKRLQQDPPAG-IS-GAPQDNNIML--WNAVIFGPDDTPWDGGTFKLSLQF 59 Query: 358 GTRYPDEPPTARFISRI-HMN 417 YP++PPT RF+SR+ H N Sbjct: 60 SEDYPNKPPTVRFVSRMFHPN 80 >At1g14400.1 68414.m01707 ubiquitin-conjugating enzyme 1 (UBC1) E2; identical to gi:431259, SP:P25865 Length = 152 Score = 49.6 bits (113), Expect = 1e-06 Identities = 28/81 (34%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = +1 Query: 178 PRNFRLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIEC 357 P RL+ + ++ Q+ G IS G D+++ L W +I GP TP++ + L ++ Sbjct: 4 PARKRLMRDFKRLQQDPPAG-IS-GAPQDNNIML--WNAVIFGPDDTPWDGGTFKLSLQF 59 Query: 358 GTRYPDEPPTARFISRI-HMN 417 YP++PPT RF+SR+ H N Sbjct: 60 SEDYPNKPPTVRFVSRMFHPN 80 >At5g62540.1 68418.m07849 ubiquitin-conjugating enzyme 3 (UBC3) E2; identical to gi:431261, SP:P42746 Length = 150 Score = 48.0 bits (109), Expect = 4e-06 Identities = 28/84 (33%), Positives = 45/84 (53%), Gaps = 1/84 (1%) Frame = +1 Query: 169 VVVPRNFRLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLK 348 + P RL+ + ++ QK G IS G D++ + HW +I GP TP++ + L Sbjct: 1 MTTPAKKRLMWDFKRLQKDPPVG-IS-GAPQDNN--IMHWNALIFGPEDTPWDGGTFKLT 56 Query: 349 IECGTRYPDEPPTARFISRI-HMN 417 + YP++PP RF+SR+ H N Sbjct: 57 LHFTEDYPNKPPIVRFVSRMFHPN 80 >At5g50870.1 68418.m06304 ubiquitin-conjugating enzyme, putative strong similarity to ubiquitin conjugating enzyme [Lycopersicon esculentum] GI:886679; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 192 Score = 46.0 bits (104), Expect = 2e-05 Identities = 27/85 (31%), Positives = 44/85 (51%) Frame = +1 Query: 190 RLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRY 369 R+ +EL+ ++ I +SD+ LT TG I GP TPYE + + I Y Sbjct: 6 RIQKELQDCERNQDSSGIRVCPKSDN---LTRLTGTIPGPIGTPYEGGTFQIDITMPDGY 62 Query: 370 PDEPPTARFISRIHMNCVNSQTGLV 444 P EPP +F +++ ++SQ+G + Sbjct: 63 PFEPPKMQFSTKVWHPNISSQSGAI 87 >At3g08690.1 68416.m01010 ubiquitin-conjugating enzyme 11 (UBC11) E2; identical to gi:12643427, SP:P35134 Length = 148 Score = 45.6 bits (103), Expect = 2e-05 Identities = 25/80 (31%), Positives = 42/80 (52%) Frame = +1 Query: 190 RLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRY 369 R+L+EL+ QK S G ++D + HW I+GPP +PY ++ + I Y Sbjct: 5 RILKELKDLQKDP-PSNCSAGPVAED---MFHWQATIMGPPESPYAGGVFLVSIHFPPDY 60 Query: 370 PDEPPTARFISRIHMNCVNS 429 P +PP F ++++ +NS Sbjct: 61 PFKPPKVSFKTKVYHPNINS 80 >At1g36340.1 68414.m04516 ubiquitin-conjugating enzyme family protein similar to Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) from {Schizosaccharomyces pombe} SP|P46595, {Caenorhabditis elegans} SP|P35129; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 154 Score = 45.6 bits (103), Expect = 2e-05 Identities = 21/55 (38%), Positives = 31/55 (56%) Frame = +1 Query: 286 WTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQTGLVDN 450 WT +I GP TPYE M++L I+ T YP +PP F + I+ +N + + N Sbjct: 39 WTAVIRGPDGTPYEGGMFNLSIKFPTDYPFKPPKFTFKTPIYHPNINDEGSICMN 93 >At5g41700.4 68418.m05071 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 149 Score = 44.0 bits (99), Expect = 6e-05 Identities = 24/80 (30%), Positives = 40/80 (50%) Frame = +1 Query: 190 RLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRY 369 R+L+EL+ QK I G ++D + HW I+GP +PY ++ + I Y Sbjct: 5 RILKELKDLQKDPPTSCIFAGPVAED---MFHWQATIMGPAESPYSGGVFLVTIHFPPDY 61 Query: 370 PDEPPTARFISRIHMNCVNS 429 P +PP F +++ +NS Sbjct: 62 PFKPPKVAFRTKVFHPNINS 81 >At3g46460.1 68416.m05037 ubiquitin-conjugating enzyme 13 (UBC13) E2; identical to gi:992706 Length = 166 Score = 43.2 bits (97), Expect = 1e-04 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 265 DDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRI-HMN 417 D+ + W+ IIGPP T YE + + YP+ PPT RF S I H N Sbjct: 30 DEKNIFEWSVTIIGPPDTLYEGGFFYAIMSFPQNYPNSPPTVRFTSDIWHPN 81 >At3g13550.1 68416.m01703 ubiquitin-conjugating enzyme (COP10) identical to ubiquitin-conjugating enzyme COP10 [Arabidopsis thaliana] GI:20065779; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 182 Score = 42.7 bits (96), Expect = 1e-04 Identities = 20/45 (44%), Positives = 26/45 (57%) Frame = +1 Query: 277 LTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIH 411 L HW IIGP TPYE ++ L I + YP +PP F +RI+ Sbjct: 65 LYHWIATIIGPSGTPYEGGIFFLDIIFPSDYPFKPPKLVFKTRIY 109 >At5g59300.1 68418.m07430 ubiquitin-conjugating enzyme 7 (UBC7) E2; identical to gi:992703, SP:P42747 Length = 198 Score = 41.9 bits (94), Expect = 3e-04 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = +1 Query: 256 ESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFIS 402 +S D + W+ IIGPP T YE ++ + YP+ PPT RF S Sbjct: 59 QSCDCYNIFEWSVTIIGPPDTLYEGGFFNAIMTFPQNYPNSPPTVRFTS 107 >At4g27960.2 68417.m04012 ubiquitin-conjugating enzyme E2-17 kDa 9 (UBC9) E2; identical to gi:297883, SP:P35132; identical to cDNA UBC9 for ubiquitin conjugating enzyme homolog GI:297883 Length = 178 Score = 41.9 bits (94), Expect = 3e-04 Identities = 26/92 (28%), Positives = 46/92 (50%) Frame = +1 Query: 154 NPSSGVVVPRNFRLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENR 333 N G++ + R+L+EL+ QK + S G ++D + HW I+GP +PY Sbjct: 23 NLDRGILEMASKRILKELKDLQKDPPT-SCSAGPVAED---MFHWQATIMGPSDSPYSGG 78 Query: 334 MYSLKIECGTRYPDEPPTARFISRIHMNCVNS 429 ++ + I YP +PP F +++ +NS Sbjct: 79 VFLVTIHFPPDYPFKPPKVAFRTKVFHPNINS 110 >At3g24515.1 68416.m03077 ubiquitin-conjugating enzyme, putative similar to Ubiquitin-conjugating enzyme E2 (Ubiquitin-protein ligase) (Ubiquitin carrier protein) from {Xenopus laevis} SP|P51669, {Schizosaccharomyces pombe} SP|P46595, {Caenorhabditis elegans} SP|P35129; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 409 Score = 41.1 bits (92), Expect = 4e-04 Identities = 25/69 (36%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = +1 Query: 259 SDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRI-HMNCVNSQT 435 S D T + I GP T Y N +++LKI+ RYP +PP F + I H N NS Sbjct: 38 SGDFSTFSTIDAQIEGPEDTVYANGIFNLKIQIPERYPFQPPIVSFATPIYHPNIDNSGR 97 Query: 436 GLVDNRQVP 462 +D +P Sbjct: 98 ICLDILNLP 106 >At3g08700.1 68416.m01011 ubiquitin-conjugating enzyme, putative strong similar to ubiquitin-conjugating enzymes E2-17 from [Arabidopsis thaliana] SP|P35134, SP|P35132, SP|P35133; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 149 Score = 41.1 bits (92), Expect = 4e-04 Identities = 21/81 (25%), Positives = 43/81 (53%) Frame = +1 Query: 190 RLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRY 369 R+ EL Q+ S G +++D + HW I+GP +PY ++++ I+ + Y Sbjct: 5 RISRELRDMQRHP-PANCSAGPVAEED--IFHWQATIMGPHDSPYSGGVFTVSIDFSSDY 61 Query: 370 PDEPPTARFISRIHMNCVNSQ 432 P +PP F ++++ ++S+ Sbjct: 62 PFKPPKVNFKTKVYHPNIDSK 82 >At5g41700.3 68418.m05068 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 145 Score = 40.7 bits (91), Expect = 6e-04 Identities = 24/80 (30%), Positives = 41/80 (51%) Frame = +1 Query: 190 RLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRY 369 R+L+EL+ QK + S G ++D + HW I+GP +PY ++ + I Y Sbjct: 5 RILKELKDLQKDPPT-SCSAGPVAED---MFHWQATIMGPAESPYSGGVFLVTIHFPPDY 60 Query: 370 PDEPPTARFISRIHMNCVNS 429 P +PP F +++ +NS Sbjct: 61 PFKPPKVAFRTKVFHPNINS 80 >At5g41700.2 68418.m05070 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 148 Score = 40.7 bits (91), Expect = 6e-04 Identities = 24/80 (30%), Positives = 41/80 (51%) Frame = +1 Query: 190 RLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRY 369 R+L+EL+ QK + S G ++D + HW I+GP +PY ++ + I Y Sbjct: 5 RILKELKDLQKDPPT-SCSAGPVAED---MFHWQATIMGPAESPYSGGVFLVTIHFPPDY 60 Query: 370 PDEPPTARFISRIHMNCVNS 429 P +PP F +++ +NS Sbjct: 61 PFKPPKVAFRTKVFHPNINS 80 >At5g41700.1 68418.m05069 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 148 Score = 40.7 bits (91), Expect = 6e-04 Identities = 24/80 (30%), Positives = 41/80 (51%) Frame = +1 Query: 190 RLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRY 369 R+L+EL+ QK + S G ++D + HW I+GP +PY ++ + I Y Sbjct: 5 RILKELKDLQKDPPT-SCSAGPVAED---MFHWQATIMGPAESPYSGGVFLVTIHFPPDY 60 Query: 370 PDEPPTARFISRIHMNCVNS 429 P +PP F +++ +NS Sbjct: 61 PFKPPKVAFRTKVFHPNINS 80 >At5g53300.2 68418.m06625 ubiquitin-conjugating enzyme 10 (UBC10) E2; identical to gi:297877, SP:P35133 Length = 148 Score = 40.3 bits (90), Expect = 8e-04 Identities = 24/80 (30%), Positives = 41/80 (51%) Frame = +1 Query: 190 RLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRY 369 R+L+EL+ QK + S G ++D + HW I+GP +PY ++ + I Y Sbjct: 5 RILKELKDLQKDPPT-SCSAGPVAED---MFHWQATIMGPSESPYAGGVFLVTIHFPPDY 60 Query: 370 PDEPPTARFISRIHMNCVNS 429 P +PP F +++ +NS Sbjct: 61 PFKPPKVAFRTKVFHPNINS 80 >At5g53300.1 68418.m06624 ubiquitin-conjugating enzyme 10 (UBC10) E2; identical to gi:297877, SP:P35133 Length = 148 Score = 40.3 bits (90), Expect = 8e-04 Identities = 24/80 (30%), Positives = 41/80 (51%) Frame = +1 Query: 190 RLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRY 369 R+L+EL+ QK + S G ++D + HW I+GP +PY ++ + I Y Sbjct: 5 RILKELKDLQKDPPT-SCSAGPVAED---MFHWQATIMGPSESPYAGGVFLVTIHFPPDY 60 Query: 370 PDEPPTARFISRIHMNCVNS 429 P +PP F +++ +NS Sbjct: 61 PFKPPKVAFRTKVFHPNINS 80 >At1g64230.1 68414.m07276 ubiquitin-conjugating enzyme, putative identical or nearly so to Ubiquitin-conjugating enzymes SP|P35132, SP|P35131, SP|P35133 from {Arabidopsis thaliana}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 40.3 bits (90), Expect = 8e-04 Identities = 25/80 (31%), Positives = 41/80 (51%) Frame = +1 Query: 190 RLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRY 369 R+L+EL+ QK + S G ++D + HW I+GP +PY ++ + I Y Sbjct: 5 RILKELKDLQKDPPT-SCSAGPVAED---MFHWQATIMGPSDSPYSGGVFLVTIHFPPDY 60 Query: 370 PDEPPTARFISRIHMNCVNS 429 P +PP F +++ VNS Sbjct: 61 PFKPPKVAFRTKVFHPNVNS 80 >At4g27960.1 68417.m04011 ubiquitin-conjugating enzyme E2-17 kDa 9 (UBC9) E2; identical to gi:297883, SP:P35132; identical to cDNA UBC9 for ubiquitin conjugating enzyme homolog GI:297883 Length = 148 Score = 39.9 bits (89), Expect = 0.001 Identities = 24/80 (30%), Positives = 41/80 (51%) Frame = +1 Query: 190 RLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRY 369 R+L+EL+ QK + S G ++D + HW I+GP +PY ++ + I Y Sbjct: 5 RILKELKDLQKDPPT-SCSAGPVAED---MFHWQATIMGPSDSPYSGGVFLVTIHFPPDY 60 Query: 370 PDEPPTARFISRIHMNCVNS 429 P +PP F +++ +NS Sbjct: 61 PFKPPKVAFRTKVFHPNINS 80 >At2g16740.1 68415.m01920 ubiquitin-conjugating enzyme, putative strong similarity to SP|P35133 Ubiquitin-conjugating enzyme E2-17 kDa 10 (EC 6.3.2.19) (Ubiquitin- protein ligase 10) (Ubiquitin carrier protein 10) {Arabidopsis thaliana}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 39.1 bits (87), Expect = 0.002 Identities = 23/80 (28%), Positives = 41/80 (51%) Frame = +1 Query: 190 RLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRY 369 R+L+EL++ Q+ + S G +D + HW I+GP +PY ++ + I Y Sbjct: 5 RILKELKELQRDP-PVSCSAGPTGED---MFHWQATIMGPNESPYSGGVFLVNIHFPPDY 60 Query: 370 PDEPPTARFISRIHMNCVNS 429 P +PP F +++ +NS Sbjct: 61 PFKPPKVVFRTKVFHPNINS 80 >At1g78870.2 68414.m09194 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 153 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = +1 Query: 259 SDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIH 411 S+D+M ++ MI+GP ++PYE ++ L++ YP P RF+++I+ Sbjct: 30 SEDNMR--YFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIY 78 >At1g78870.1 68414.m09193 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 112 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = +1 Query: 259 SDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIH 411 S+D+M ++ MI+GP ++PYE ++ L++ YP P RF+++I+ Sbjct: 30 SEDNMR--YFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIY 78 >At1g16890.2 68414.m02044 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 153 Score = 39.1 bits (87), Expect = 0.002 Identities = 15/51 (29%), Positives = 30/51 (58%) Frame = +1 Query: 259 SDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIH 411 S + + ++ MI+GP ++PYE ++ L++ YP P RF+++I+ Sbjct: 28 SPSEENMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIY 78 >At3g55380.1 68416.m06151 ubiquitin-conjugating enzyme 14 (UBC14) E2; UbcAT3; identical to gi:2129757, S46656 Length = 167 Score = 38.3 bits (85), Expect = 0.003 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 265 DDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRI-HMN 417 D+ + W+ I+GPP T YE ++ + YP PPT F S + H N Sbjct: 31 DEKNVFQWSVSIMGPPDTLYEGGFFNAIMSFPENYPVSPPTVTFTSEMWHPN 82 >At1g16890.1 68414.m02043 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 120 Score = 37.9 bits (84), Expect = 0.004 Identities = 14/45 (31%), Positives = 28/45 (62%) Frame = +1 Query: 277 LTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIH 411 + ++ MI+GP ++PYE ++ L++ YP P RF+++I+ Sbjct: 1 MRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIY 45 >At1g45050.1 68414.m05165 ubiquitin-conjugating enzyme 15 (UBC15) E2; identical to ubiquitin-conjugating enzyme 15 GI:2801442 from [Arabidopsis thaliana] Length = 161 Score = 37.1 bits (82), Expect = 0.007 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = +1 Query: 277 LTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFIS 402 L WT + G P T Y N Y L++E YP E P F+S Sbjct: 43 LQKWTIDVTGAPGTLYANETYQLQVEFPEHYPMEAPQVVFVS 84 >At5g05080.1 68418.m00539 ubiquitin-conjugating enzyme, putative similar to SP|Q16763 Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier protein) {Homo sapiens}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 251 Score = 36.7 bits (81), Expect = 0.009 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +1 Query: 298 IIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRI-HMNCVNS 429 I GP TPYEN ++ +K+ +P PP F+++I H N ++ Sbjct: 46 IEGPVGTPYENGLFRMKLALSHDFPHSPPKGYFMTKIFHPNVASN 90 >At2g32790.1 68415.m04014 ubiquitin-conjugating enzyme, putative similar to ubiquitin conjugating enzyme from [Oryza sativa] GI:1373001, {Arabidopsis thaliana} SP|P35134, SP|P35131; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 177 Score = 36.7 bits (81), Expect = 0.009 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 1/77 (1%) Frame = +1 Query: 190 RLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRY 369 RL +E ++ + SW L S ++ + W + GP PYE ++++ + +Y Sbjct: 33 RLWKEFQEKDDVLKIHVRSW-LPSPEN--IFRWEATVNGPVGCPYEKGVFTVSVHIPPKY 89 Query: 370 PDEPPTARFISRI-HMN 417 P EPP F ++I H N Sbjct: 90 PYEPPKITFKTKIFHPN 106 >At3g17000.1 68416.m02171 ubiquitin-conjugating enzyme, putative similar to Non-Canonical UBiquitin Conjugating Enzyme 1 (NCUBE1) from [Gallus gallus] GI:7362937, [Mus musculus] GI:7363050, [Homo sapiens] GI:7362973; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 309 Score = 35.1 bits (77), Expect = 0.029 Identities = 20/66 (30%), Positives = 34/66 (51%) Frame = +1 Query: 190 RLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRY 369 R+L+E+++ Q D +S LE + + W I GP T +E +Y +I+ Y Sbjct: 15 RILQEVKEMQANPSDDFMSLPLEEN----IFEWQFAIRGPGDTEFEGGIYHGRIQLPADY 70 Query: 370 PDEPPT 387 P +PP+ Sbjct: 71 PFKPPS 76 >At5g42990.1 68418.m05243 ubiquitin-conjugating enzyme 18 (UBC18) E2; identical to gi:2801448 Length = 161 Score = 34.3 bits (75), Expect = 0.050 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +1 Query: 277 LTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFI 399 L W + G P T Y N Y+L++E YP E P F+ Sbjct: 43 LQKWVIEVTGAPGTLYANETYNLQVEFPQHYPMEAPQVIFV 83 >At5g56150.2 68418.m07005 ubiquitin-conjugating enzyme, putative strong similarity to ubiquitin-conjugating enzyme UBC2 [Mesembryanthemum crystallinum] GI:5762457, UBC4 [Pisum sativum] GI:456568; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 33.9 bits (74), Expect = 0.067 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = +1 Query: 265 DDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNS 429 DDM W I+GP +P+ ++ + I YP +PP F ++++ +NS Sbjct: 28 DDMF--QWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINS 80 >At5g56150.1 68418.m07004 ubiquitin-conjugating enzyme, putative strong similarity to ubiquitin-conjugating enzyme UBC2 [Mesembryanthemum crystallinum] GI:5762457, UBC4 [Pisum sativum] GI:456568; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 33.9 bits (74), Expect = 0.067 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = +1 Query: 265 DDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNS 429 DDM W I+GP +P+ ++ + I YP +PP F ++++ +NS Sbjct: 28 DDMF--QWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINS 80 >At2g46030.1 68415.m05726 ubiquitin-conjugating enzyme 6 (UBC6) E2; identical to gi|431267, SP:P42750, PIR:S52661; contains a ubiquitin-conjugating enzymes active site (PDOC00163) Length = 183 Score = 33.5 bits (73), Expect = 0.088 Identities = 16/61 (26%), Positives = 34/61 (55%) Frame = +1 Query: 262 DDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQTGL 441 +DD+ + + T GP + Y+ ++ +K+E YP + P+ F+++I+ V+ +G Sbjct: 26 NDDLQMFYVT--FHGPTDSLYQGGVWKIKVELPEAYPYKSPSVGFVNKIYHPNVDESSGA 83 Query: 442 V 444 V Sbjct: 84 V 84 >At1g75440.1 68414.m08763 ubiquitin-conjugating enzyme 16 (UBC16) E2; identical to gi:2801444, GB:AAC39325 from [Arabidopsis thaliana] (Plant Mol. Biol. 23 (2), 387-396 (1993)) Length = 161 Score = 33.5 bits (73), Expect = 0.088 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +1 Query: 277 LTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFI 399 L W +IG P T Y N Y L+++ YP E P F+ Sbjct: 43 LQRWIIEVIGAPGTLYANDTYQLQVDFPEHYPMESPQVIFL 83 >At1g50490.1 68414.m05662 ubiquitin-conjugating enzyme 20 (UBC20) nearly identical to ubiquitin-conjugating enzyme UBC20 [Arabidopsis thaliana] GI:22530867; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 180 Score = 33.1 bits (72), Expect = 0.12 Identities = 24/69 (34%), Positives = 30/69 (43%) Frame = +1 Query: 190 RLLEELEQGQKGVGDGTISWGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRY 369 RL EL G G G IS E D+ + W G I G T +E Y L + Y Sbjct: 39 RLQSELMGLMMGGGPG-ISAFPEEDN---IFCWKGTITGSKDTVFEGTEYRLSLSFSNDY 94 Query: 370 PDEPPTARF 396 P +PP +F Sbjct: 95 PFKPPKVKF 103 >At1g63800.1 68414.m07220 ubiquitin-conjugating enzyme 5 (UBC5) E2; identical to gi:431269, SP:P42749 Length = 185 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +1 Query: 304 GPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQTGLV 444 GP + YE ++ +++E YP + P+ FI++I+ V+ +G V Sbjct: 38 GPKDSIYEGGVWKIRVELPDAYPYKSPSVGFITKIYHPNVDEMSGSV 84 >At2g33770.1 68415.m04141 ubiquitin-conjugating enzyme family protein low similarity to ubiquitin-conjugating BIR-domain enzyme APOLLON [Homo sapiens] GI:8489831, ubiquitin-conjugating enzyme [Mus musculus] GI:3319990; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 907 Score = 31.9 bits (69), Expect = 0.27 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 298 IIGPPRTPYENRMYSLKIECGTRYPDEPPTARFIS 402 ++G P TPY + ++ I +YP EPP + S Sbjct: 698 LVGAPGTPYHDGLFFFDIMLPPQYPHEPPMVHYHS 732 >At4g36410.1 68417.m05173 ubiquitin-conjugating enzyme 17 (UBC17) E2; identical to gi:2801446 Length = 161 Score = 31.5 bits (68), Expect = 0.36 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +1 Query: 277 LTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARF 396 L W + G P T Y N Y L++E YP E P F Sbjct: 43 LQRWIIEVHGVPGTLYANETYQLQVEFPEHYPMEAPQVIF 82 >At5g41340.1 68418.m05024 ubiquitin-conjugating enzyme 4 (UBC4) E2; identical to gi:431265, SP:P42748 Length = 187 Score = 30.7 bits (66), Expect = 0.62 Identities = 13/47 (27%), Positives = 27/47 (57%) Frame = +1 Query: 304 GPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQTGLV 444 GP + Y+ ++ +++E YP + P+ FI++I+ V+ +G V Sbjct: 38 GPKDSLYQGGVWKIRVELPDAYPYKSPSVGFITKIYHPNVDELSGSV 84 >At1g53020.1 68414.m06002 ubiquitin-conjugating enzyme family protein similar to ubiquitin-conjugating enzyme GB:3319990 from [Mus musculus]; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 1163 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +1 Query: 295 MIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFIS---RIHMNCVN 426 +IIG TPY + ++ I+ YP PP + S RI+ N N Sbjct: 306 VIIGAEGTPYHDGLFFFDIQFPDTYPSVPPNVHYHSGGLRINPNLYN 352 Score = 29.5 bits (63), Expect = 1.4 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +1 Query: 295 MIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFIS---RIHMNCVNSQTGLV 444 +IIG TPY + ++ I+ YP PP + S RI+ N N LV Sbjct: 952 VIIGAEGTPYHDGLFFFDIQFPDTYPSVPPNVYYHSGGLRINPNLYNCGKVLV 1004 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 295 MIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFIS 402 +IIG TPY + ++ I+ YP PP + S Sbjct: 640 VIIGAEGTPYHDGLFFFDIQFPDTYPSVPPKVHYHS 675 >At3g57870.1 68416.m06451 ubiquitin-conjugating enzyme, putative strong similarity to SP|P50550 Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO- 1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) {Xenopus laevis}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 160 Score = 29.5 bits (63), Expect = 1.4 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 1/70 (1%) Frame = +1 Query: 190 RLLEELEQGQKGVGDGTISWGLESDDD-MTLTHWTGMIIGPPRTPYENRMYSLKIECGTR 366 RL EE + +K G ++ D + L W I G T +E + L + Sbjct: 9 RLAEERKSWRKNHPHGFVAKPETGQDGTVNLMVWHCTIPGKAGTDWEGGFFPLTMHFSED 68 Query: 367 YPDEPPTARF 396 YP +PP +F Sbjct: 69 YPSKPPKCKF 78 >At1g55915.1 68414.m06413 expressed protein similar to Hypothetical 30.6 kDa protein in ACT5-YCK1 intergenic region (Swiss-Prot:P38838) [Saccharomyces cerevisiae]; similar to Yhr134wp (GI:500671) [Saccharomyces cerevisiae] Length = 404 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -3 Query: 375 IRVSCSTFNFKGVHSILVGCPWWANNHSSPMSKSH 271 IR +C++ N K V C W+N HS P S SH Sbjct: 236 IRETCTSVNGKSVKR----CNSWSNAHSCPPSSSH 266 >At3g20060.1 68416.m02537 ubiquitin-conjugating enzyme 19 (UBC19) nearly identical to ubiquitin-conjugating enzyme UBC19 [Arabidopsis thaliana] GI:22530865; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 181 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = +1 Query: 286 WTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARF 396 W G I G T +E Y L + YP + P +F Sbjct: 68 WKGTITGSKDTVFEGTEYRLSLTFSNDYPFKSPKVKF 104 >At5g16590.1 68418.m01942 leucine-rich repeat transmembrane protein kinase, putative Length = 625 Score = 27.9 bits (59), Expect = 4.4 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 331 RMYSLKIECGTRYPDEPPTARFISRI 408 R+ ++ I C T+YPD PT ++R+ Sbjct: 584 RLLNIGISCTTQYPDSRPTMPEVTRL 609 >At3g15355.1 68416.m01945 ubiquitin-conjugating enzyme-related similar to ubiquitin-conjugating enzyme (GI:3319990) [Mus musculus]; similar to Baculoviral IAP repeat-containing protein 6 (Ubiquitin-conjugating BIR-domain enzyme apollon) (Swiss-Prot:Q9NR09) [Homo sapiens]; Length = 609 Score = 27.9 bits (59), Expect = 4.4 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +1 Query: 295 MIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFIS---RIHMNCVN 426 +IIG TPY + ++ I YP PP + S RI+ N N Sbjct: 367 VIIGAQGTPYHDGLFFFDIFFPDTYPSTPPIVHYHSGGLRINPNLYN 413 >At5g08200.1 68418.m00959 peptidoglycan-binding LysM domain-containing protein contains Pfam profile PF01476: LysM domain Length = 409 Score = 27.5 bits (58), Expect = 5.8 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -1 Query: 239 VPSPTPFWPCSSSSKRRKFRGTTTPDDGF 153 +PSPT P SSSS F G+ +PD G+ Sbjct: 51 IPSPTSSPPPSSSSP--PFHGSNSPDRGY 77 >At2g47310.1 68415.m05906 flowering time control protein-related / FCA gamma-related Length = 512 Score = 27.5 bits (58), Expect = 5.8 Identities = 16/41 (39%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = -1 Query: 236 PSPTPFWPCSSSS--KRRKFRGTTTPDDGFAMITVSPA*RT 120 P P P PC SS KRR T D A + V+P +T Sbjct: 80 PPPFPPSPCGGSSLRKRRSQSATDNADGSIAKLYVAPISKT 120 >At2g31030.1 68415.m03783 oxysterol-binding family protein similar to SWH1 [Saccharomyces cerevisiae] GI:402658; contains Pfam profile PF01237: Oxysterol-binding protein Length = 489 Score = 27.5 bits (58), Expect = 5.8 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +1 Query: 190 RLLEELEQGQKGVGDGTISWGLESDDDM 273 RL EE Q G D I+ G ESDDD+ Sbjct: 68 RLSEEYTQTNTGPDDDWITNGFESDDDV 95 >At2g16920.1 68415.m01949 ubiquitin-conjugating enzyme family protein low similarity to ubiquitin-conjugating BIR-domain enzyme APOLLON [Homo sapiens] GI:8489831, ubiquitin-conjugating enzyme [Mus musculus] GI:3319990; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 1102 Score = 27.5 bits (58), Expect = 5.8 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 295 MIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFIS 402 +I+G TPY++ ++ + YP PP+A + S Sbjct: 885 VIVGAFGTPYQDGLFFFDFHLPSDYPSVPPSAYYHS 920 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,573,180 Number of Sequences: 28952 Number of extensions: 245994 Number of successful extensions: 646 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 643 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -