BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306A12f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 21 5.0 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 5.0 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.6 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 21 8.7 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.4 bits (43), Expect = 5.0 Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -1 Query: 182 LVIYKM*-LSNIHNGHQIHAFVLEVFFFPNCSPSSMVVMNSQP 57 +VI+K + N N ++ V ++ C+P+ +V +NS+P Sbjct: 91 IVIFKTKDMRNSTNIFLVNLSVADLMVLLVCTPTVLVEVNSRP 133 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.4 bits (43), Expect = 5.0 Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -1 Query: 182 LVIYKM*-LSNIHNGHQIHAFVLEVFFFPNCSPSSMVVMNSQP 57 +VI+K + N N ++ V ++ C+P+ +V +NS+P Sbjct: 91 IVIFKTKDMRNSTNIFLVNLSVADLMVLLVCTPTVLVEVNSRP 133 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 6.6 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = -1 Query: 401 LFIFLVKSKHVLLMMLYENKLNC 333 LF F + ++ ++ +L+ + NC Sbjct: 979 LFFFCMAAEFIIAALLHPQEFNC 1001 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 6.6 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = -1 Query: 401 LFIFLVKSKHVLLMMLYENKLNC 333 LF F + ++ ++ +L+ + NC Sbjct: 979 LFFFCMAAEFIIAALLHPQEFNC 1001 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 20.6 bits (41), Expect = 8.7 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = +3 Query: 129 VNLMTVMNVA*LHFVNY 179 ++ + +++ + LHFVNY Sbjct: 202 ISFLLIISYSTLHFVNY 218 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,262 Number of Sequences: 336 Number of extensions: 2116 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -