Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS306A12f
         (521 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta...    26   0.67 
AJ439060-14|CAD27765.1|  471|Anopheles gambiae putative acetyltr...    23   8.2  

>AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative
           TPR-containing phosphoprotein protein.
          Length = 1200

 Score = 26.2 bits (55), Expect = 0.67
 Identities = 9/30 (30%), Positives = 20/30 (66%)
 Frame = -1

Query: 407 NILFIFLVKSKHVLLMMLYENKLNCYYRYH 318
           NI  I++ + +++  + +YEN L  +YR++
Sbjct: 685 NIAHIYVEQKQYISAIQMYENCLKKFYRHN 714


>AJ439060-14|CAD27765.1|  471|Anopheles gambiae putative
           acetyltransferase protein.
          Length = 471

 Score = 22.6 bits (46), Expect = 8.2
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -1

Query: 356 LYENKLNCYYRYH 318
           LY  + NCYY Y+
Sbjct: 193 LYARRQNCYYYYY 205


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 458,100
Number of Sequences: 2352
Number of extensions: 7134
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 47783067
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)