BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306A12f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 26 0.67 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 23 8.2 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 26.2 bits (55), Expect = 0.67 Identities = 9/30 (30%), Positives = 20/30 (66%) Frame = -1 Query: 407 NILFIFLVKSKHVLLMMLYENKLNCYYRYH 318 NI I++ + +++ + +YEN L +YR++ Sbjct: 685 NIAHIYVEQKQYISAIQMYENCLKKFYRHN 714 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 22.6 bits (46), Expect = 8.2 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -1 Query: 356 LYENKLNCYYRYH 318 LY + NCYY Y+ Sbjct: 193 LYARRQNCYYYYY 205 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 458,100 Number of Sequences: 2352 Number of extensions: 7134 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -