BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306A11f (506 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC56E4.06c |ggt2||gamma-glutamyltranspeptidase Ggt2|Schizosacc... 26 3.7 SPBC16D10.08c |||heat shock protein Hsp104 |Schizosaccharomyces ... 25 4.9 >SPAC56E4.06c |ggt2||gamma-glutamyltranspeptidase Ggt2|Schizosaccharomyces pombe|chr 1|||Manual Length = 611 Score = 25.8 bits (54), Expect = 3.7 Identities = 13/44 (29%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = +2 Query: 104 YNRLR*MYRSWNRK*LRLDYSQVRLAF--FSLYVYIYTLYFDAH 229 +++LR + +W R+ R +SQ AF +L+V +Y++ + H Sbjct: 24 WHKLRNYHGAWYRRISRRRFSQFIFAFGLMTLFVLVYSISSNLH 67 >SPBC16D10.08c |||heat shock protein Hsp104 |Schizosaccharomyces pombe|chr 2|||Manual Length = 905 Score = 25.4 bits (53), Expect = 4.9 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = -2 Query: 352 DRSILVGVPPVPTQSPHPEILTMT*RSASDIKNYNVL 242 +RS+ + +P Q P PE +T++ SA ++N + L Sbjct: 65 ERSVTSRLVRLPAQDPPPEQVTLSPESAKLLRNAHEL 101 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,996,017 Number of Sequences: 5004 Number of extensions: 38821 Number of successful extensions: 62 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 202220600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -