BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306A11f (506 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80848-1|AAB37990.3| 389|Caenorhabditis elegans Hypothetical pr... 30 0.84 >U80848-1|AAB37990.3| 389|Caenorhabditis elegans Hypothetical protein T10H10.3 protein. Length = 389 Score = 30.3 bits (65), Expect = 0.84 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 5/59 (8%) Frame = -2 Query: 454 PTKSQEXTXGKRIXRNS-----IVIXKTIPKWNRKN*WSDRSILVGVPPVPTQSPHPEI 293 P S E T GK + R S + + + R + IL VPP PT +P PEI Sbjct: 8 PVTSVEGTQGKYVKRESPPTVPSLAATAVSRTRRSPIAASTLILSSVPPPPTSTPPPEI 66 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,125,354 Number of Sequences: 27780 Number of extensions: 220799 Number of successful extensions: 454 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 454 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 977860456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -