BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306A08f (379 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3H7.12 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 28 0.56 SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc... 24 9.1 >SPBC3H7.12 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 287 Score = 27.9 bits (59), Expect = 0.56 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -3 Query: 269 KMIQETKVNHLYHLPFMINLSNRFKLQGSQDIVHCF-VAGDSEV 141 + I +T NHL+ P NL+ F + + +H F ++G +EV Sbjct: 181 RQIHKTVRNHLFSPPLPSNLALSFSISNASVCLHLFRLSGPNEV 224 >SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1463 Score = 23.8 bits (49), Expect = 9.1 Identities = 13/52 (25%), Positives = 23/52 (44%) Frame = +3 Query: 150 VPGNEAMDNVLGALKFESVTEINHERQMIQMIYFCFLNHFNKNSPIIALKLI 305 +P E N+ + ++ ++ + M FLNH+ II LKL+ Sbjct: 211 LPPAERSSNLTIVFEKNWISHAKKKKSSLYMWGVLFLNHWKLTVVIIVLKLV 262 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,254,051 Number of Sequences: 5004 Number of extensions: 21011 Number of successful extensions: 40 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 122233080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -