BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306A08f (379 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 6.4 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 6.4 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 6.4 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 20 8.4 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 20.6 bits (41), Expect = 6.4 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 242 HLYHLPFMINLSNRFKLQGSQDIVHCFVAG 153 ++Y LPF+ ++ + + G V C VAG Sbjct: 487 NVYGLPFIRHMDKKAIVAGETLRVTCPVAG 516 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 20.6 bits (41), Expect = 6.4 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 191 QGSQDIVHCFVAGDSEVSV 135 +G +HC V GD+ V+V Sbjct: 821 KGDTATLHCEVHGDTPVTV 839 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 20.6 bits (41), Expect = 6.4 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 191 QGSQDIVHCFVAGDSEVSV 135 +G +HC V GD+ V+V Sbjct: 817 KGDTATLHCEVHGDTPVTV 835 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 20.2 bits (40), Expect = 8.4 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +1 Query: 130 WNTDTSESPATKQ 168 W +DTS+ P + Q Sbjct: 223 WKSDTSDGPESHQ 235 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,038 Number of Sequences: 438 Number of extensions: 1633 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9176370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -