BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306A07f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0461 - 3328662-3329087,3329124-3329201,3329370-3329597,333... 28 4.0 02_01_0046 - 311752-312138,312220-312372,312458-312653,312702-31... 28 4.0 10_08_0654 - 19616426-19616656,19617046-19617249,19617654-196178... 27 9.1 03_01_0502 - 3779551-3779562,3779863-3780012,3780129-3780172,378... 27 9.1 >02_01_0461 - 3328662-3329087,3329124-3329201,3329370-3329597, 3330181-3330204 Length = 251 Score = 28.3 bits (60), Expect = 4.0 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -1 Query: 428 RSRCSQGIQYRIPCRLCKRPARFGT*TPA 342 +SRCS+ ++ CR+C+ + GT T A Sbjct: 147 KSRCSRTVKDETSCRICQTRGQLGTNTRA 175 >02_01_0046 - 311752-312138,312220-312372,312458-312653,312702-312792, 312808-313228 Length = 415 Score = 28.3 bits (60), Expect = 4.0 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +3 Query: 327 NSSLNCRSLCSKTRRSLTEPTGDSIL-NSLRTTRTVKL 437 N SLN ++LC +T R + DSIL N L T + +KL Sbjct: 25 NLSLNFKTLCPRTSRGNFKCKIDSILRNHLGTAKILKL 62 >10_08_0654 - 19616426-19616656,19617046-19617249,19617654-19617824, 19619617-19620411 Length = 466 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 361 LEHKLRQFKLEFVGVQNPRHPIIDDFVDVCLVQCPPRFRSNTDFV 227 L+ R++KL FV + +P HP F CL P + +FV Sbjct: 179 LQRAQREYKLLFVYLHSPDHPDTPAFCGGCLCAEPVAAFIDENFV 223 >03_01_0502 - 3779551-3779562,3779863-3780012,3780129-3780172, 3780256-3780319,3780422-3780655,3780765-3780908, 3781027-3781221,3781447-3781522,3781689-3781788, 3781955-3781988,3782076-3782160,3782226-3782290, 3782380-3782478,3782810-3782875,3785485-3785721 Length = 534 Score = 27.1 bits (57), Expect = 9.1 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +2 Query: 50 VCILLASVAIATSYSIKDNEIELPRLRTSDDLLDSVISDCFE-AGSPMACL 199 VCI +A+ A+ + +S+KD + + T+D + +V F G P+A L Sbjct: 397 VCIAMAATALISFWSLKDFHGTVQKAITADKSIKAVCLVLFAFLGVPLAVL 447 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,038,573 Number of Sequences: 37544 Number of extensions: 276663 Number of successful extensions: 909 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 878 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 909 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -