BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306A05f (457 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L36067-1|AAA29362.1| 229|Anopheles gambiae polyubiquitin protein. 85 1e-18 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 22 8.9 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 22 8.9 >L36067-1|AAA29362.1| 229|Anopheles gambiae polyubiquitin protein. Length = 229 Score = 84.6 bits (200), Expect = 1e-18 Identities = 41/76 (53%), Positives = 49/76 (64%) Frame = +1 Query: 148 MLIKVKTLTGKEIEIDIEPTDXXXXXXXXXXXXXGIPPQQQRLIFSGKQMNDEKTAQDYK 327 M I VKTLTGK I +++EP+D GIPP QQRLIF+GKQ+ D +T DY Sbjct: 1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60 Query: 328 VQGGSVLHLVLALRGG 375 +Q S LHLVL LRGG Sbjct: 61 IQKESTLHLVLRLRGG 76 Score = 84.6 bits (200), Expect = 1e-18 Identities = 41/76 (53%), Positives = 49/76 (64%) Frame = +1 Query: 148 MLIKVKTLTGKEIEIDIEPTDXXXXXXXXXXXXXGIPPQQQRLIFSGKQMNDEKTAQDYK 327 M I VKTLTGK I +++EP+D GIPP QQRLIF+GKQ+ D +T DY Sbjct: 77 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136 Query: 328 VQGGSVLHLVLALRGG 375 +Q S LHLVL LRGG Sbjct: 137 IQKESTLHLVLRLRGG 152 Score = 84.6 bits (200), Expect = 1e-18 Identities = 41/76 (53%), Positives = 49/76 (64%) Frame = +1 Query: 148 MLIKVKTLTGKEIEIDIEPTDXXXXXXXXXXXXXGIPPQQQRLIFSGKQMNDEKTAQDYK 327 M I VKTLTGK I +++EP+D GIPP QQRLIF+GKQ+ D +T DY Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212 Query: 328 VQGGSVLHLVLALRGG 375 +Q S LHLVL LRGG Sbjct: 213 IQKESTLHLVLRLRGG 228 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 22.2 bits (45), Expect = 8.9 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 219 KNQRKSRRKGRHSAAATASHIF 284 + RKSRR RH+ +A S IF Sbjct: 202 QKNRKSRRVTRHNWSAIYSLIF 223 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 22.2 bits (45), Expect = 8.9 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 219 KNQRKSRRKGRHSAAATASHIF 284 + RKSRR RH+ +A S IF Sbjct: 203 QKNRKSRRVTRHNWSAIYSLIF 224 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 395,139 Number of Sequences: 2352 Number of extensions: 5902 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39119412 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -