BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306A03f (521 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000D57350 Cluster: PREDICTED: hypothetical protein;... 41 0.015 UniRef50_UPI0000DB7786 Cluster: PREDICTED: hypothetical protein;... 36 0.43 >UniRef50_UPI0000D57350 Cluster: PREDICTED: hypothetical protein; n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical protein - Tribolium castaneum Length = 289 Score = 41.1 bits (92), Expect = 0.015 Identities = 20/33 (60%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = -2 Query: 160 AKKEAVIEK-KNRKNKAGAEVEKPADFDDGNWE 65 A K VIE+ KN+KN EKP DFDDGNWE Sbjct: 118 ANKNKVIEEVKNKKNLKKFLSEKPVDFDDGNWE 150 >UniRef50_UPI0000DB7786 Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 293 Score = 36.3 bits (80), Expect = 0.43 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -2 Query: 163 LAKKEAVIEKKNRKNKAGAEVEKPADFDDGNWE 65 + K+ + + KN+KN EKP DFD+G+WE Sbjct: 127 VGKENKIEQVKNKKNLKNLFQEKPIDFDEGDWE 159 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 315,380,189 Number of Sequences: 1657284 Number of extensions: 4545528 Number of successful extensions: 10761 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10759 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32619212418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -