BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS306A03f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3119| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_50720| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 >SB_3119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 29.1 bits (62), Expect = 2.3 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 369 SCR*YWTTRNLPKPRIKKRRRSLHPTDLH 283 S R YW RN+ + ++ K RR L ++LH Sbjct: 14 SLRLYWLQRNVRREKLPKARRPLLSSELH 42 >SB_50720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 433 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 477 LTHRSCSLLRWYPLF*FVRRWYLFLGSVLLN 385 LTH S + WYP+F + ++L L +L+N Sbjct: 214 LTHVKESQMTWYPIFVSIASFFLPLFIILVN 244 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,949,286 Number of Sequences: 59808 Number of extensions: 150556 Number of successful extensions: 396 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 396 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -