BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305H10f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1259.02c |||aminopeptidase |Schizosaccharomyces pombe|chr 3|... 28 0.73 SPBC418.02 |||NatA N-acetyltransferase complex subunit |Schizosa... 26 3.0 >SPCC1259.02c |||aminopeptidase |Schizosaccharomyces pombe|chr 3|||Manual Length = 822 Score = 28.3 bits (60), Expect = 0.73 Identities = 16/57 (28%), Positives = 27/57 (47%) Frame = -1 Query: 392 PLFDTYH*SRSKHGRPAFAEINELSKILMLSPILGQDVIVTLLHNGYRSFKLEITIA 222 PL D Y +G P F+E N L ++ LS +G ++ T+ R + + +A Sbjct: 42 PLVDPY----DANGNPQFSEANALKHVIHLSDDIGYRILGTIEQERAREYIMNEVLA 94 >SPBC418.02 |||NatA N-acetyltransferase complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 695 Score = 26.2 bits (55), Expect = 3.0 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 125 GVSAKFTKVQNYWHTYCLCAQIFK 196 G SAK W TYCLC +K Sbjct: 354 GDSAKNIPTHKLWCTYCLCLAHYK 377 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,974,420 Number of Sequences: 5004 Number of extensions: 38251 Number of successful extensions: 64 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -