BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305H10f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0335 + 2412766-2415655,2416108-2416208,2416871-2416895,241... 28 5.2 06_01_1191 + 10240754-10240909,10241477-10241547,10241872-10242910 27 6.9 02_05_0788 + 31758119-31758384,31758482-31758634,31759385-317595... 27 6.9 >06_01_0335 + 2412766-2415655,2416108-2416208,2416871-2416895, 2416977-2417049,2417191-2417373,2418164-2418227, 2418427-2418447,2418862-2418905,2420575-2420650, 2421359-2421373 Length = 1163 Score = 27.9 bits (59), Expect = 5.2 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +3 Query: 153 KIIGIHTVYVPKFLKPICMYLLLSNRDFQFKR 248 +++ + Y+P LKP +YL + DF+ +R Sbjct: 375 QVLALSYKYLPSHLKPCFLYLSIFPEDFEIQR 406 >06_01_1191 + 10240754-10240909,10241477-10241547,10241872-10242910 Length = 421 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 153 KIIGIHTVYVPKFLKPICMYLLLSNRDFQFKR 248 K++ + Y+P +KP +YL + DF +R Sbjct: 3 KVVALSYNYLPSHVKPCFLYLCIFPEDFDVQR 34 >02_05_0788 + 31758119-31758384,31758482-31758634,31759385-31759509, 31759650-31759678,31760943-31761008,31761059-31761125, 31761226-31761370,31761404-31761451,31762014-31762182, 31762645-31762779,31762858-31763064,31763608-31763735, 31763815-31763866,31764046-31764060,31764502-31764609 Length = 570 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 68 DIAKSKGNKSFKGRTHSPRAEF 3 ++ K KGN +FKGR S EF Sbjct: 465 ELLKEKGNSAFKGRKWSKAVEF 486 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,720,017 Number of Sequences: 37544 Number of extensions: 209025 Number of successful extensions: 424 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 424 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -