BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305H10f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132862-17|CAB60551.1| 266|Caenorhabditis elegans Hypothetical... 32 0.22 >AL132862-17|CAB60551.1| 266|Caenorhabditis elegans Hypothetical protein Y73F8A.23 protein. Length = 266 Score = 32.3 bits (70), Expect = 0.22 Identities = 17/66 (25%), Positives = 30/66 (45%) Frame = -1 Query: 425 LRTNF*YSRYIPLFDTYH*SRSKHGRPAFAEINELSKILMLSPILGQDVIVTLLHNGYRS 246 + TNF R F ++ + AF + N + K+ M P+ G D + + + + Sbjct: 68 ITTNFYIFRQGKEFHVVQKTKESGEKVAFKKTNNMCKVSMPKPLFGNDTVTEIYQSETVA 127 Query: 245 FKLEIT 228 +K EIT Sbjct: 128 YKYEIT 133 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,746,309 Number of Sequences: 27780 Number of extensions: 209212 Number of successful extensions: 438 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 433 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 438 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -