BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305H09f (457 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/c... 25 1.7 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 24 2.2 DQ437578-1|ABD96048.1| 234|Anopheles gambiae short neuropeptide... 24 2.9 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 2.9 AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein ... 23 6.7 >CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/calmodulin-dependentprotein kinase, CAKI protein. Length = 872 Score = 24.6 bits (51), Expect = 1.7 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -2 Query: 234 DLTESIWEHMTGLLVGTVTDVGHQVLTLESPADSVVNTSR 115 D+ + H L + D+G + TLE+ D V +T+R Sbjct: 833 DMLRQAYGHFFDLTIVN-NDIGETIATLENAIDKVHSTAR 871 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 24.2 bits (50), Expect = 2.2 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 167 CPTSVTVPTRRPVICSQMDSV 229 CP + +P+RR C Q D + Sbjct: 420 CPVRINIPSRRCYRCWQTDHI 440 >DQ437578-1|ABD96048.1| 234|Anopheles gambiae short neuropeptide F prepropeptide protein. Length = 234 Score = 23.8 bits (49), Expect = 2.9 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 129 QQSPQAIQGSILDAQHRLRFQQEDPSYA 212 QQ Q +I Q RLRF + DPS+A Sbjct: 146 QQDDVMQQKTIRAPQLRLRFGRTDPSWA 173 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.8 bits (49), Expect = 2.9 Identities = 10/23 (43%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -1 Query: 226 GIHLGAYDGSSCWNRNRC-WASS 161 G +LGA ++CWN + W SS Sbjct: 2749 GAYLGAASANNCWNPLKWDWRSS 2771 >AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein L8 protein. Length = 261 Score = 22.6 bits (46), Expect = 6.7 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 145 RFKGQYLMPNIGYGSNKKTRHMLPNGFRKVL 237 R G Y K+TR LP+G +KVL Sbjct: 128 RTSGNYASVIAHNPDTKRTRVKLPSGAKKVL 158 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 449,891 Number of Sequences: 2352 Number of extensions: 9418 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39119412 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -