BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305H08f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41501| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_1970| Best HMM Match : DDOST_48kD (HMM E-Value=0) 27 9.4 >SB_41501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 748 Score = 27.5 bits (58), Expect = 7.1 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -2 Query: 274 IKYGCFCTIVFCSAAC 227 I++GCFC +V+ S C Sbjct: 666 IRWGCFCVLVYVSIGC 681 >SB_1970| Best HMM Match : DDOST_48kD (HMM E-Value=0) Length = 415 Score = 27.1 bits (57), Expect = 9.4 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -3 Query: 333 LAADHTSEISGFCFK*FLYILNTVVSVQLCSAQL-LAGTSETHLMF 199 +AA HT +GFC L L++ + Q L A T ETH +F Sbjct: 1 MAALHTCRFAGFCLLFLLSFLHSSFAGQRTLVLLDNANTKETHSIF 46 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,278,158 Number of Sequences: 59808 Number of extensions: 219039 Number of successful extensions: 315 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 315 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -