BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305H07f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29066| Best HMM Match : No HMM Matches (HMM E-Value=.) 242 1e-64 SB_1026| Best HMM Match : PDZ (HMM E-Value=9.7e-08) 28 5.4 SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 >SB_29066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 242 bits (593), Expect = 1e-64 Identities = 111/140 (79%), Positives = 125/140 (89%) Frame = +1 Query: 7 LKKKRIFRKFTYRGVDLDQLLDMPNEQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKK 186 +K+KR FRKFTYRGVDLDQLLD+ +EQLMEL+ GLKRKP+AL+K+LR+AKK Sbjct: 10 IKRKRTFRKFTYRGVDLDQLLDLSHEQLMELVCCRQRRRFTRGLKRKPLALMKRLRKAKK 69 Query: 187 EAPPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKTFNQVEIKPEMIGHYLGEFSVTYKP 366 EA P EKPE+VKTHLRNMIIVPEM+GS+VG+YNGKTF QVEIKPEMIGHYLGEFS+TYKP Sbjct: 70 EAAPMEKPEVVKTHLRNMIIVPEMIGSVVGVYNGKTFTQVEIKPEMIGHYLGEFSITYKP 129 Query: 367 VKHGRPGIGATHSSRFIPLK 426 VKHGRPGIGATHSSRFIPLK Sbjct: 130 VKHGRPGIGATHSSRFIPLK 149 >SB_1026| Best HMM Match : PDZ (HMM E-Value=9.7e-08) Length = 924 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/62 (25%), Positives = 35/62 (56%) Frame = -3 Query: 348 ELSEVMADHLRLDFNLVKSFSVVNADN*TDHLGNDDHVSQVSLHDLWLLIRRSLFLGATQ 169 +LSE++ LDF+ + SV++ D+ T N+ H S ++ +L + ++ LG+ + Sbjct: 769 DLSELIVPPPMLDFDDGDASSVLSTDSFTTSHTNNTHNSTTTVDELLQVCWSAVLLGSVE 828 Query: 168 LL 163 ++ Sbjct: 829 VV 830 >SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3235 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +1 Query: 307 EIKPEMIGHYLGEFSVTYKPVKHGRPGIGATHSSRFIP 420 ++KP++ + G ++V Y P K GR I + R +P Sbjct: 1714 DLKPDVKDNGDGTYTVAYVPDKPGRYNIDVKYGDRRVP 1751 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,898,497 Number of Sequences: 59808 Number of extensions: 257339 Number of successful extensions: 585 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 585 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -