BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305H06f (521 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P85195 Cluster: Lipocalin-2; n=2; Obtectomera|Rep: Lipo... 44 0.002 UniRef50_A7ASI0 Cluster: Putative uncharacterized protein; n=1; ... 34 2.3 >UniRef50_P85195 Cluster: Lipocalin-2; n=2; Obtectomera|Rep: Lipocalin-2 - Lonomia obliqua (Moth) Length = 53 Score = 44.4 bits (100), Expect = 0.002 Identities = 19/31 (61%), Positives = 24/31 (77%) Frame = +2 Query: 281 EGHARAAEAVVQHNTEAVRQAAEASREIHET 373 + HARA EA VQ+NT+A RQ AEA+R HE+ Sbjct: 16 QDHARAVEAAVQYNTDATRQVAEANRAAHES 46 >UniRef50_A7ASI0 Cluster: Putative uncharacterized protein; n=1; Babesia bovis|Rep: Putative uncharacterized protein - Babesia bovis Length = 565 Score = 33.9 bits (74), Expect = 2.3 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +2 Query: 107 RIRHEGTMRFLIAFVAIIGYASAGAILSHLAYGVNPG 217 R+RH + RF+ + +AIIGY+ IL + +G NPG Sbjct: 156 RLRHHPSGRFVNSKIAIIGYSMGSLILHEILHG-NPG 191 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,333,402 Number of Sequences: 1657284 Number of extensions: 1959781 Number of successful extensions: 7402 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7200 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7401 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32619212418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -