BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305H02f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1274 + 28897491-28897707,28897804-28897935,28898029-288980... 28 4.0 06_01_1082 - 8847795-8848033,8848511-8848724 28 5.2 >06_03_1274 + 28897491-28897707,28897804-28897935,28898029-28898096, 28898216-28898280,28898468-28898534,28898630-28898917, 28898995-28899102,28899236-28899487,28899918-28899997, 28900092-28900185,28900728-28900810,28901319-28901873, 28902085-28902616 Length = 846 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -3 Query: 231 YENDVLFFIYNRQFNDALELGTIVNASGDRKAVGHDGEVAGLPD 100 Y V FF YN+ F+ + + T+V +G+ ++G G + L D Sbjct: 764 YSGSVGFFSYNKTFDLNIVIRTVVLHNGE-ASIGAGGAIVALSD 806 >06_01_1082 - 8847795-8848033,8848511-8848724 Length = 150 Score = 27.9 bits (59), Expect = 5.2 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -3 Query: 297 RVVYGGNSADSTR--EQWFFQPAKYENDVLFFIYNRQFNDALELG 169 + Y G++A R + W Y DVL F YN++++D +G Sbjct: 42 KTYYVGDAAGWGRNLDWWLAGKTFYAGDVLVFKYNKEYHDVAVVG 86 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,194,617 Number of Sequences: 37544 Number of extensions: 221614 Number of successful extensions: 660 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 660 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -