Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS305G12f
         (521 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY873913-1|AAW67569.2|  377|Tribolium castaneum chitinase 2 prot...    24   0.94 
EF222296-1|ABN79656.2|  403|Tribolium castaneum arginine vasopre...    21   6.6  

>AY873913-1|AAW67569.2|  377|Tribolium castaneum chitinase 2
           protein.
          Length = 377

 Score = 23.8 bits (49), Expect = 0.94
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 2/44 (4%)
 Frame = +3

Query: 357 RVSGNKQKVSELSQLIERQW--YEDRGAVEAAVSLAKGHDLAAV 482
           RV  ++QKV    +  + QW  Y+D  +V   V  AK H++A +
Sbjct: 308 RVFDDQQKVPYKYK--DDQWIGYDDEESVALKVQFAKDHNMAGL 349


>EF222296-1|ABN79656.2|  403|Tribolium castaneum arginine
           vasopressin receptor protein.
          Length = 403

 Score = 21.0 bits (42), Expect = 6.6
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +1

Query: 130 YCGWSSRR 153
           YC W+SRR
Sbjct: 148 YCSWTSRR 155


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 88,908
Number of Sequences: 336
Number of extensions: 1430
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12573240
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)