BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305G12f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 30 0.054 CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. 23 4.7 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 23 8.2 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 23 8.2 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 23 8.2 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 29.9 bits (64), Expect = 0.054 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +3 Query: 9 FEHKFNLDRQMMSHDEDWPEADSNVDIESISEPQLKRLQ 125 F HK NL R M HD PE+ + ++E++ E + K++Q Sbjct: 429 FRHKGNLIRHMAMHD---PESTVSKEMEALREGRQKKVQ 464 >CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. Length = 295 Score = 23.4 bits (48), Expect = 4.7 Identities = 14/47 (29%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +1 Query: 121 CSRYCG--WSSRRYSTSTRCPSRRGSHPKRSGRKRAPCSACP*RRWS 255 C + CG W R S+ PS G+H R P RW+ Sbjct: 207 CRKTCGTGWKYRSISSLHAPPSHPGAHRAAEPRLDWRIKILPLPRWN 253 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 22.6 bits (46), Expect = 8.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 136 GWSSRRYSTSTRCPSRRGSHPKRSGR 213 G SRR+ T + RR HP R+GR Sbjct: 112 GEPSRRW-TRSGATGRRQPHPYRAGR 136 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 22.6 bits (46), Expect = 8.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 136 GWSSRRYSTSTRCPSRRGSHPKRSGR 213 G SRR+ T + RR HP R+GR Sbjct: 112 GEPSRRW-TRSGATGRRQPHPYRAGR 136 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 22.6 bits (46), Expect = 8.2 Identities = 6/31 (19%), Positives = 17/31 (54%) Frame = +3 Query: 375 QKVSELSQLIERQWYEDRGAVEAAVSLAKGH 467 + +++ ++R W E+R + + +L+ H Sbjct: 1022 EAAKQITSALQRDWNEERARLAVSSTLSPSH 1052 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 420,141 Number of Sequences: 2352 Number of extensions: 6807 Number of successful extensions: 35 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -