BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305G09f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 26 0.23 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 26 0.23 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 23 1.2 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 2.2 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 22 2.9 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 22 2.9 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 3.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 3.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 3.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 3.8 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 21 6.6 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 25.8 bits (54), Expect = 0.23 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = -3 Query: 453 LTLPFILFKNNSFGCRKLSPEIFISLFNLNHNFSKRKRVQKYFVFI 316 +TL +I+ RK+ PE L N+N + +K Q+ +F+ Sbjct: 323 MTLLYIICNEGHHATRKMGPEFRERLLNVNLSAVDQKTRQEVHMFL 368 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 25.8 bits (54), Expect = 0.23 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = -3 Query: 453 LTLPFILFKNNSFGCRKLSPEIFISLFNLNHNFSKRKRVQKYFVFI 316 +TL +I+ RK+ PE L N+N + +K Q+ +F+ Sbjct: 323 MTLLYIICNEGHHATRKMGPEFRERLLNVNLSAVDQKTRQEVHMFL 368 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 23.4 bits (48), Expect = 1.2 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 207 YFCLNRFNTFLCAIFT 254 Y C N FN FL +FT Sbjct: 161 YCCDNNFNVFLRQVFT 176 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.6 bits (46), Expect = 2.2 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -1 Query: 212 KIFYYLCFSYQRGSIICFMIYSYFWTVILI 123 +I+Y+ C S + F++ S ++TV L+ Sbjct: 55 RIYYFYCVSITFNVHLLFLLCSGYFTVHLL 84 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -3 Query: 93 KKKSYIMYIKSTFHNLYT 40 K KSY T HN+YT Sbjct: 6 KVKSYFTTHHDTLHNIYT 23 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -3 Query: 93 KKKSYIMYIKSTFHNLYT 40 K KSY T HN+YT Sbjct: 6 KVKSYFTTHHDTLHNIYT 23 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 3.8 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -2 Query: 331 IFCFHSKTITSCINLINIKFSIQTIEVKMAH 239 + C H K +LINI S++ + ++ H Sbjct: 1120 MLCTHQKAGDEKASLINIADSLEMLNKRLDH 1150 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 3.8 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -2 Query: 331 IFCFHSKTITSCINLINIKFSIQTIEVKMAH 239 + C H K +LINI S++ + ++ H Sbjct: 1120 MLCTHQKAGDEKASLINIADSLEMLNKRLDH 1150 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 3.8 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -2 Query: 331 IFCFHSKTITSCINLINIKFSIQTIEVKMAH 239 + C H K +LINI S++ + ++ H Sbjct: 1120 MLCTHQKAGDEKASLINIADSLEMLNKRLDH 1150 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 3.8 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -2 Query: 331 IFCFHSKTITSCINLINIKFSIQTIEVKMAH 239 + C H K +LINI S++ + ++ H Sbjct: 1120 MLCTHQKAGDEKASLINIADSLEMLNKRLDH 1150 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.0 bits (42), Expect = 6.6 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -2 Query: 286 INIKFSIQTIEVKMAHRNVLNLFKQKYF 203 +N KF ++K + NLFK YF Sbjct: 108 LNNKFQYIDEKLKTRDQKERNLFKNAYF 135 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,971 Number of Sequences: 336 Number of extensions: 2585 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -