BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305G09f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC594.07c |||sequence orphan|Schizosaccharomyces pombe|chr 3||... 26 3.0 SPAC6G9.02c |nop9||RNA-binding protein Nop9|Schizosaccharomyces ... 26 3.9 SPCC569.06 |||S. pombe specific multicopy membrane protein famil... 26 3.9 SPAC2G11.03c |vps45||vacuolar sorting protein Vps 45|Schizosacch... 25 5.2 >SPCC594.07c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 255 Score = 26.2 bits (55), Expect = 3.0 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -2 Query: 325 CFHSKTITSCINLINIKFSIQTIEVKMAH--RNVLNLFKQKYFI 200 CF C N +N ++S+ + MA +VLN QK F+ Sbjct: 115 CFSRANPIKCSNQVNTQYSVSFLFTIMASVLISVLNYISQKIFL 158 >SPAC6G9.02c |nop9||RNA-binding protein Nop9|Schizosaccharomyces pombe|chr 1|||Manual Length = 655 Score = 25.8 bits (54), Expect = 3.9 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +2 Query: 416 KLLFLNNINGNVSSVYEKLLLLSMFRMRKSFLS 514 +L+ NN+ G S V EKL LS R KSF S Sbjct: 101 ELIVCNNVFG--SKVLEKLFPLSTSRQIKSFFS 131 >SPCC569.06 |||S. pombe specific multicopy membrane protein family 1|Schizosaccharomyces pombe|chr 3|||Manual Length = 478 Score = 25.8 bits (54), Expect = 3.9 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = -1 Query: 206 FYYLCFSYQRGSIICFMIYSYFWTVILIA*IIPTVLMSRKKVIL 75 F CF+Y G I + +YS F T ++ T+ + KK++L Sbjct: 278 FVVSCFTYFLGDGIEYALYSLFITTTVLG--FGTIRRTSKKMVL 319 >SPAC2G11.03c |vps45||vacuolar sorting protein Vps 45|Schizosaccharomyces pombe|chr 1|||Manual Length = 558 Score = 25.4 bits (53), Expect = 5.2 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -3 Query: 444 PFILFKNNSFGCRKLSPEIFISLFNLNHNFSKRK 343 P I + NNS C KL+ E+ ++ + + F+ RK Sbjct: 173 PVIRYDNNSLLCLKLAEEVSYTIQHESQLFNFRK 206 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,980,111 Number of Sequences: 5004 Number of extensions: 38482 Number of successful extensions: 83 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -