BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305G09f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0223 - 21419128-21419397,21419493-21419747,21420243-214204... 29 1.7 02_02_0654 - 12662931-12663200,12663296-12663550,12664097-126642... 29 2.3 01_07_0234 + 42194805-42195041,42195055-42195325,42195974-421960... 27 9.1 >11_06_0223 - 21419128-21419397,21419493-21419747,21420243-21420414, 21420530-21420757,21420916-21421049,21421309-21421392, 21421554-21421760,21421871-21422203,21422343-21422449, 21422823-21422988,21423127-21423230,21423347-21423507, 21423595-21424495,21424642-21424732,21424837-21425127, 21425491-21425575,21425665-21425747,21427653-21427773, 21427785-21428260 Length = 1422 Score = 29.5 bits (63), Expect = 1.7 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -3 Query: 219 LNKNILLSVL*LPKR*YNLFYDLFIFLDGY 130 +N+ +++S+L P YNLF D+ + +GY Sbjct: 421 MNETVMISLLQPPPETYNLFDDIILLSEGY 450 >02_02_0654 - 12662931-12663200,12663296-12663550,12664097-12664268, 12664354-12664581,12664727-12664860,12665018-12665101, 12665332-12665538,12665641-12665973,12666175-12666281, 12666439-12666593,12666778-12666810,12666924-12666972, 12667152-12667312,12667413-12668313,12668391-12668481, 12668558-12668749 Length = 1123 Score = 29.1 bits (62), Expect = 2.3 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -3 Query: 219 LNKNILLSVL*LPKR*YNLFYDLFIFLDGY 130 +N+ +++S+L P YNLF D+ + +GY Sbjct: 133 MNETVMISLLQPPPETYNLFDDIVLLSEGY 162 >01_07_0234 + 42194805-42195041,42195055-42195325,42195974-42196047, 42196062-42196253 Length = 257 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = -3 Query: 453 LTLPFILFKNNSFGCRKLSPEIFISLFNL 367 +T+P I+F + FG R++ P+ + FN+ Sbjct: 188 MTIPIIMFLSGGFG-RRMFPDFIFAQFNI 215 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,399,646 Number of Sequences: 37544 Number of extensions: 170696 Number of successful extensions: 298 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 298 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -