BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305G09f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59410| Best HMM Match : Rsd_AlgQ (HMM E-Value=6.5) 31 0.76 SB_55200| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) 31 0.76 SB_49614| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) 31 0.76 SB_47439| Best HMM Match : E6 (HMM E-Value=3.2) 31 0.76 SB_40579| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) 31 0.76 SB_27702| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_26781| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_10674| Best HMM Match : E6 (HMM E-Value=3.2) 31 0.76 SB_55070| Best HMM Match : OAR (HMM E-Value=0.92) 31 0.76 SB_18736| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 >SB_59410| Best HMM Match : Rsd_AlgQ (HMM E-Value=6.5) Length = 180 Score = 30.7 bits (66), Expect = 0.76 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = +1 Query: 19 FRNLKLLGI*VVKSRFY----IHNITFFLDIKTVGIIYAISI 132 + N L G V+K FY IH++TF L+ K + ++YA ++ Sbjct: 107 YHNTALRGESVLKGHFYLRDNIHDMTFTLNEKRIAVVYAATV 148 >SB_55200| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) Length = 929 Score = 30.7 bits (66), Expect = 0.76 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = +1 Query: 19 FRNLKLLGI*VVKSRFY----IHNITFFLDIKTVGIIYAISI 132 + N L G V+K FY IH++TF L+ K + ++YA ++ Sbjct: 856 YHNTALRGESVLKGHFYLRDNIHDMTFTLNEKRIAVVYAATV 897 >SB_49614| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) Length = 838 Score = 30.7 bits (66), Expect = 0.76 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = +1 Query: 19 FRNLKLLGI*VVKSRFY----IHNITFFLDIKTVGIIYAISI 132 + N L G V+K FY IH++TF L+ K + ++YA ++ Sbjct: 765 YHNTALRGESVLKGHFYLRDNIHDMTFTLNEKRIAVVYAATV 806 >SB_47439| Best HMM Match : E6 (HMM E-Value=3.2) Length = 436 Score = 30.7 bits (66), Expect = 0.76 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = +1 Query: 19 FRNLKLLGI*VVKSRFY----IHNITFFLDIKTVGIIYAISI 132 + N L G V+K FY IH++TF L+ K + ++YA ++ Sbjct: 363 YHNTALRGESVLKGHFYLRDNIHDMTFTLNEKRIAVVYAATV 404 >SB_40579| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) Length = 929 Score = 30.7 bits (66), Expect = 0.76 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = +1 Query: 19 FRNLKLLGI*VVKSRFY----IHNITFFLDIKTVGIIYAISI 132 + N L G V+K FY IH++TF L+ K + ++YA ++ Sbjct: 856 YHNTALRGESVLKGHFYLRDNIHDMTFTLNEKRIAVVYAATV 897 >SB_27702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 30.7 bits (66), Expect = 0.76 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = +1 Query: 19 FRNLKLLGI*VVKSRFY----IHNITFFLDIKTVGIIYAISI 132 + N L G V+K FY IH++TF L+ K + ++YA ++ Sbjct: 25 YHNTALRGESVLKGHFYLRDNIHDMTFTLNEKRIAVVYAATV 66 >SB_26781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 707 Score = 30.7 bits (66), Expect = 0.76 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = +1 Query: 19 FRNLKLLGI*VVKSRFY----IHNITFFLDIKTVGIIYAISI 132 + N L G V+K FY IH++TF L+ K + ++YA ++ Sbjct: 634 YHNTALRGESVLKGHFYLRDNIHDMTFTLNEKRIAVVYAATV 675 >SB_10674| Best HMM Match : E6 (HMM E-Value=3.2) Length = 436 Score = 30.7 bits (66), Expect = 0.76 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = +1 Query: 19 FRNLKLLGI*VVKSRFY----IHNITFFLDIKTVGIIYAISI 132 + N L G V+K FY IH++TF L+ K + ++YA ++ Sbjct: 363 YHNTALRGESVLKGHFYLRDNIHDMTFTLNEKRIAVVYAATV 404 >SB_55070| Best HMM Match : OAR (HMM E-Value=0.92) Length = 396 Score = 30.7 bits (66), Expect = 0.76 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = +1 Query: 19 FRNLKLLGI*VVKSRFY----IHNITFFLDIKTVGIIYAISI 132 + N L G V+K FY IH++TF L+ K + ++YA ++ Sbjct: 323 YHNTALRGESVLKGHFYLRDNIHDMTFTLNEKRIAVVYAATV 364 >SB_18736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1452 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 4/32 (12%) Frame = +1 Query: 49 VVKSRFY----IHNITFFLDIKTVGIIYAISI 132 V+K FY IH++TF L+ K + ++YA ++ Sbjct: 1418 VLKGHFYLRDNIHDMTFTLNEKRIAVVYAATV 1449 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,131,125 Number of Sequences: 59808 Number of extensions: 233765 Number of successful extensions: 420 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 420 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -