BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305G09f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 5.8 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 21 7.7 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 7.7 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 5.8 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +3 Query: 108 RYNLCNKYNRPKI*INHKTDYTTSLVTKAQI 200 +YN NKYN N K Y ++ QI Sbjct: 97 KYNYNNKYNYNNNNYNKKLYYKNYIINIEQI 127 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 374 NNEINISGDNFLHP 415 N ++N+SGDN P Sbjct: 181 NIQVNVSGDNVPQP 194 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/33 (24%), Positives = 16/33 (48%) Frame = +2 Query: 383 INISGDNFLHPKLLFLNNINGNVSSVYEKLLLL 481 + + D P ++ NN +GN Y+ +L+ Sbjct: 101 LRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLI 133 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,031 Number of Sequences: 438 Number of extensions: 2796 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -