BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305G07f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 29 0.033 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 2.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 2.9 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 22 3.8 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 22 3.8 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 22 3.8 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 6.6 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 28.7 bits (61), Expect = 0.033 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +1 Query: 310 YAHTPGTTIELTCEAAGSPAPSVHWFKND 396 +++T G +E C A G+P P + W ++D Sbjct: 35 FSNTTGAVVE--CSAHGNPTPDIIWVRSD 61 Score = 28.7 bits (61), Expect = 0.033 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 322 PGTTIELTCEAAGSPAPSVHW 384 PG ++ L C A+G+P P + W Sbjct: 427 PGNSVFLKCIASGNPTPEITW 447 Score = 27.1 bits (57), Expect = 0.10 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 334 IELTCEAAGSPAPSVHWFK 390 + L C A G P+PS W+K Sbjct: 250 VALLCPAQGFPSPSFRWYK 268 Score = 25.4 bits (53), Expect = 0.31 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = +1 Query: 325 GTTIELTCEAAGSPAPSVHWFKNDSPV 405 G TC G+P ++ W K+ P+ Sbjct: 342 GRPATFTCNFEGNPIKTISWLKDGHPI 368 Score = 22.6 bits (46), Expect = 2.2 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +1 Query: 313 AHTPGTTIELTCEAAGSPAPSVHW 384 A G+ + C+A G P P V W Sbjct: 709 AFAQGSDAAVECKADGFPRPVVTW 732 Score = 21.8 bits (44), Expect = 3.8 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 325 GTTIELTCEAAGSPAPSVHW 384 G T+ + C AG P SV W Sbjct: 525 GGTLIVHCPFAGHPVDSVVW 544 Score = 21.0 bits (42), Expect = 6.6 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +1 Query: 334 IELTCEAAGSPAPSVHW 384 + L C A G P P + W Sbjct: 1324 VTLPCLAVGLPPPVITW 1340 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 2.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 329 VPGVCAYDGRGPCVIDKYL 273 VPGV A R PC I++ L Sbjct: 197 VPGVVAMFSRKPCSINENL 215 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 2.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 329 VPGVCAYDGRGPCVIDKYL 273 VPGV A R PC I++ L Sbjct: 197 VPGVVAMFSRKPCSINENL 215 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.8 bits (44), Expect = 3.8 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = +1 Query: 448 PTSIARISSTLI 483 PTS+ +ISSTL+ Sbjct: 75 PTSVTKISSTLL 86 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.8 bits (44), Expect = 3.8 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +1 Query: 235 IENGVQAKSDGSH--KYLSITQGPLPSYAHTPGTTIELTCEAA 357 I+ G +A +G + KYL + + Y H P T E AA Sbjct: 429 IKFGRKADPNGDYIRKYLPVLKNMPSQYIHEPWTAPEQVQRAA 471 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 21.8 bits (44), Expect = 3.8 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = +1 Query: 199 KHIKLLSDIDNSIENGVQAKSDGSHKYLSITQGPLPS 309 K I+ S IDN NG + H+ + P P+ Sbjct: 218 KRIEEKSQIDNLFHNGFMQEQSTHHQGQLVVGLPAPT 254 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.0 bits (42), Expect = 6.6 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 271 HKYLSITQGPLPSYAHTPGT 330 H+Y T PLPS H+ T Sbjct: 392 HQYGYNTLSPLPSSVHSHST 411 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,853 Number of Sequences: 336 Number of extensions: 2165 Number of successful extensions: 13 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -