BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305G06f (459 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6Q930 Cluster: Putative uncharacterized protein; n=1; ... 33 3.9 UniRef50_Q4N760 Cluster: Putative uncharacterized protein; n=2; ... 33 3.9 UniRef50_Q6CIN5 Cluster: Similarities with sgd|S0004044 Saccharo... 31 9.0 >UniRef50_A6Q930 Cluster: Putative uncharacterized protein; n=1; Sulfurovum sp. NBC37-1|Rep: Putative uncharacterized protein - Sulfurovum sp. (strain NBC37-1) Length = 305 Score = 32.7 bits (71), Expect = 3.9 Identities = 17/49 (34%), Positives = 28/49 (57%) Frame = -3 Query: 307 YXILDESYFISLCIIIRYLLYTPLLSIAYCLS*KLKQLRNTIDYDCGGL 161 Y I D + FI L I+ LL+ PLL+I ++ + +++T+ YD L Sbjct: 202 YTIKDSAIFIGLSILAFPLLFVPLLNIFIQIALWIWLIKDTMGYDAAAL 250 >UniRef50_Q4N760 Cluster: Putative uncharacterized protein; n=2; Theileria|Rep: Putative uncharacterized protein - Theileria parva Length = 473 Score = 32.7 bits (71), Expect = 3.9 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +1 Query: 4 SYYFTRSAFKFKCTCKNKLYYNHSKLCFKICSPADLCERILTV*KLN*NT 153 ++ F + K C+C++ + N K CF+ CS D C L V K NT Sbjct: 110 AFCFNAADDKCVCSCQSGFFGNPYKECFQHCSTNDDCSSPLAVCKSTTNT 159 >UniRef50_Q6CIN5 Cluster: Similarities with sgd|S0004044 Saccharomyces cerevisiae YLR054c hypothetical protein; n=1; Kluyveromyces lactis|Rep: Similarities with sgd|S0004044 Saccharomyces cerevisiae YLR054c hypothetical protein - Kluyveromyces lactis (Yeast) (Candida sphaerica) Length = 659 Score = 31.5 bits (68), Expect = 9.0 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 271 CIIIRYLLYTPLLSIAYCLS*KLKQLRNTID-YDCGGLKLMYFSSVF 134 C+ I Y Y IAY S +Q N D YDCG L + SS++ Sbjct: 310 CLTINYEAYCFYNEIAYPSSLLFEQCINLADKYDCGSSNLTFLSSLY 356 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 332,651,206 Number of Sequences: 1657284 Number of extensions: 5137501 Number of successful extensions: 9752 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9746 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 24351434270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -