BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305G06f (459 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0212 + 42018162-42018266,42018371-42018489,42019392-42019905 27 7.3 01_02_0095 - 11076493-11077644,11077845-11077918,11078155-11078320 27 9.6 >01_07_0212 + 42018162-42018266,42018371-42018489,42019392-42019905 Length = 245 Score = 27.1 bits (57), Expect = 7.3 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = -3 Query: 313 HTYXILDESYFISLCIIIRYLLYTPLLSIAYCLS*KLKQLRNTIDYDCG 167 H Y I D + S+C+++R + PL+ A+ + ++L + YD G Sbjct: 72 HAYCIHDYMFEESVCLLLRATWFEPLIVEAHEEALDEEELYHIYQYDDG 120 >01_02_0095 - 11076493-11077644,11077845-11077918,11078155-11078320 Length = 463 Score = 26.6 bits (56), Expect = 9.6 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 31 KFKCTCKNKLYYNHSKLCFKICSPADL 111 K C C N L SK C + +PADL Sbjct: 434 KSTCNCSNCLRNADSKTCEPLLAPADL 460 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,616,965 Number of Sequences: 37544 Number of extensions: 130577 Number of successful extensions: 178 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 178 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 907440304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -