BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305G05f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78544-1|CAB01761.1| 218|Caenorhabditis elegans Hypothetical pr... 29 2.7 U41535-13|AAB63405.1| 1075|Caenorhabditis elegans Hypothetical p... 29 2.7 Z68227-1|CAA92507.1| 320|Caenorhabditis elegans Hypothetical pr... 28 4.7 >Z78544-1|CAB01761.1| 218|Caenorhabditis elegans Hypothetical protein K04G11.1 protein. Length = 218 Score = 28.7 bits (61), Expect = 2.7 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = -3 Query: 501 KNELCDFHKNFMVFLTYFTATIFKRSRDVCATLC---LSPTTTTYHFMSLYVR 352 KN +C F +M FLT T ++++ + + L L P T F+ + +R Sbjct: 107 KNFVCKFDIEYMCFLTLKTTNLYQKLQGIYIELLLLPLLPLATVLSFLFMQIR 159 >U41535-13|AAB63405.1| 1075|Caenorhabditis elegans Hypothetical protein F18A1.1 protein. Length = 1075 Score = 28.7 bits (61), Expect = 2.7 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 388 HYHLPLYVTIRQKLGNA*VQFNPNFNWKY 302 H LP YV + KLG+ V+ + N W+Y Sbjct: 181 HNFLPKYVKLIDKLGSFAVRIDHNCRWRY 209 >Z68227-1|CAA92507.1| 320|Caenorhabditis elegans Hypothetical protein F49C12.2 protein. Length = 320 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 415 HISGSFKNCGCKICQKNHEVFMEVTKFIFNVKYVF 519 H G+F N G KICQ N E+ ++ + + +F Sbjct: 240 HRGGAFDNKGVKICQINTEIHKDLDNGVTGEQNMF 274 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,794,657 Number of Sequences: 27780 Number of extensions: 238181 Number of successful extensions: 439 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 439 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -