BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305G03f (502 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11721| Best HMM Match : Peptidase_C12 (HMM E-Value=0) 32 0.23 SB_5347| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 >SB_11721| Best HMM Match : Peptidase_C12 (HMM E-Value=0) Length = 537 Score = 32.3 bits (70), Expect = 0.23 Identities = 23/87 (26%), Positives = 45/87 (51%), Gaps = 1/87 (1%) Frame = +3 Query: 243 VLSVMLLFPISDAYENHKKTEE-NEILSKGQEVSGNIFYMKQNISNACGTIALVHSVANN 419 V + LF + + +K + +E + +E+ +IF+ +Q I N+C T AL+ SV N Sbjct: 27 VYGFIFLFKWIEERRSRRKIQHIDESFVENEEIVNDIFFAQQVIPNSCATHALL-SVLLN 85 Query: 420 TDIIELSDGHMQKFLNEAKGLDATARG 500 I+L + ++ K + +K + +G Sbjct: 86 CPHIDLGE-NVSKLKDFSKNFNPENKG 111 >SB_5347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 28.3 bits (60), Expect = 3.8 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 101 HFSHSNCGVDEGD*SIKW*QLDKSNYIFKIVER 3 HF N +D G IKW Q K+N + +++R Sbjct: 175 HFLKYNFDLDNGSVDIKWMQGAKTNICYNVLDR 207 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,872,740 Number of Sequences: 59808 Number of extensions: 288256 Number of successful extensions: 664 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 661 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -