BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305G01f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 24 1.1 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 23 1.4 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.5 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 5.8 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 7.7 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.8 bits (49), Expect = 1.1 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 371 ITSEDFDYYDYIFGMDESNMKDLNKKAPKGSKAKLL 478 I SE D Y+ M + + K L+ PKGSK ++ Sbjct: 256 IKSEPIDAYE----MHQISKKKLSPATPKGSKCSMI 287 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 23.4 bits (48), Expect = 1.4 Identities = 9/29 (31%), Positives = 20/29 (68%) Frame = +2 Query: 353 NNHARQITSEDFDYYDYIFGMDESNMKDL 439 +N ++I ++DF++ D F + +N+K+L Sbjct: 380 SNRMQKIVNDDFNFDDVNFRILGANVKEL 408 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.6 bits (46), Expect = 2.5 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +2 Query: 158 KKALFICLGNICRSPIAEAVFQKTVNDMNLGEHWDIDSAAIGG 286 K AL +C N C S ++ V V M + + A+ G Sbjct: 313 KDALIVCTVNSCTSMLSGIVIFSVVGFMAHEQQKPVADVAVSG 355 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -1 Query: 347 ERYASSKYLVLSNREDYRHASPR 279 ++YA+S + S D++H S R Sbjct: 208 KKYATSSNSLRSRTHDFQHTSSR 230 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.0 bits (42), Expect = 7.7 Identities = 12/43 (27%), Positives = 17/43 (39%) Frame = +2 Query: 158 KKALFICLGNICRSPIAEAVFQKTVNDMNLGEHWDIDSAAIGG 286 K AL +C N C S ++ V V M + + A G Sbjct: 366 KDALIVCTVNSCTSMLSGIVIFSVVGFMAHEQQKPVADVAASG 408 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,728 Number of Sequences: 438 Number of extensions: 3750 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -